SitesBLAST
Comparing WP_043744206.1 NCBI__GCF_000009985.1:WP_043744206.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7quyA Alcohol dehydrogenase from thauera aromatica complexed with nadh (see paper)
66% identity, 97% coverage: 6:354/358 of query aligns to 4:351/352 of 7quyA
- binding nicotinamide-adenine-dinucleotide: D154 (= D156), T158 (= T160), G178 (= G180), G180 (= G182), G181 (= G183), V182 (= V184), D201 (= D203), S253 (= S256), T255 (≠ S258), V275 (= V278), G276 (= G279), F277 (≠ Y280), N299 (= N302), G301 (= G304)
- binding zinc ion: C40 (= C42), H63 (= H65), E64 (= E66), C92 (= C94), C95 (= C97), C106 (= C108), D154 (= D156)
1rjwA Crystal structure of NAD(+)-dependent alcohol dehydrogenase from bacillus stearothermophilus strain lld-r (see paper)
31% identity, 95% coverage: 15:354/358 of query aligns to 11:334/339 of 1rjwA
- active site: C38 (= C42), H39 (= H43), T40 (= T44), H43 (≠ D47), H61 (= H65), E62 (= E66), C92 (= C94), C95 (= C97), C98 (= C100), C106 (= C108), K110 (= K112), C148 (≠ D156), T152 (= T160), R331 (= R351)
- binding trifluoroethanol: T40 (= T44), C148 (≠ D156), I285 (≠ W303)
- binding zinc ion: C38 (= C42), H61 (= H65), C92 (= C94), C95 (= C97), C98 (= C100), C106 (= C108)
3piiA Crystal structure of mutant of ht- alcohol dehydrogenase with substrate analogue butyramide
31% identity, 95% coverage: 15:354/358 of query aligns to 11:334/337 of 3piiA
- active site: C38 (= C42), H39 (= H43), T40 (= T44), H43 (≠ D47), H61 (= H65), E62 (= E66), C92 (= C94), C95 (= C97), C98 (= C100), C106 (= C108), K110 (= K112), C148 (≠ D156), T152 (= T160), R331 (= R351)
- binding butyramide: T40 (= T44), H61 (= H65), W87 (≠ A90), C148 (≠ D156)
- binding zinc ion: C38 (= C42), H61 (= H65), E62 (= E66), C92 (= C94), C95 (= C97), C98 (= C100), C106 (= C108), C148 (≠ D156)
Q8GIX7 Alcohol dehydrogenase; ADH; EC 1.1.1.1 from Moraxella sp. (strain TAE123) (see paper)
31% identity, 95% coverage: 14:354/358 of query aligns to 10:334/338 of Q8GIX7
- C38 (= C42) binding
- H61 (= H65) binding
- E62 (= E66) binding
- C92 (= C94) binding
- C95 (= C97) binding
- C98 (= C100) binding
- C106 (= C108) binding
- C148 (≠ D156) binding
4z6kA Alcohol dehydrogenase from the antarctic psychrophile moraxella sp. Tae 123
31% identity, 95% coverage: 14:354/358 of query aligns to 10:334/345 of 4z6kA
- active site: C38 (= C42), H39 (= H43), T40 (= T44), H43 (≠ D47), H61 (= H65), E62 (= E66), C92 (= C94), C95 (= C97), C98 (= C100), C106 (= C108), Q110 (≠ K112), C148 (≠ D156), T152 (= T160), R331 (= R351)
- binding zinc ion: C38 (= C42), H61 (= H65), C92 (= C94), C95 (= C97), C98 (= C100), C106 (= C108), C148 (≠ D156)
P12311 Alcohol dehydrogenase; ADH-T; EC 1.1.1.1 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see paper)
31% identity, 95% coverage: 15:354/358 of query aligns to 11:334/337 of P12311
- C38 (= C42) mutation to S: No activity.
- T40 (= T44) mutation to A: No activity.; mutation to S: Little decrease in activity.
- H43 (≠ D47) mutation to A: No activity.; mutation to R: Higher level of activity at pH 9.
6n7lC Crystal structure of an alcohol dehydrogenase from elizabethkingia anophelis nuhp1
30% identity, 97% coverage: 9:354/358 of query aligns to 12:340/344 of 6n7lC
- active site: C45 (= C42), T47 (= T44), H50 (≠ D47), H68 (= H65), C154 (≠ D156)
- binding nicotinamide-adenine-dinucleotide: C45 (= C42), H46 (= H43), T47 (= T44), H50 (≠ D47), C154 (≠ D156), T158 (= T160), G178 (= G180), G180 (= G182), G181 (= G183), L182 (≠ V184), D201 (= D203), V202 (≠ I204), K206 (= K208), T243 (≠ E254), A244 (≠ C255), V245 (≠ S256), S246 (≠ G257), A249 (≠ P260), N266 (≠ V278), G267 (= G279), L268 (≠ Y280), I291 (≠ W303), V292 (vs. gap)
- binding zinc ion: C45 (= C42), H68 (= H65), C98 (= C94), C101 (= C97), C104 (= C100), C112 (= C108), C154 (≠ D156)
1lluA The ternary complex of pseudomonas aeruginosa alcohol dehydrogenase with its coenzyme and weak substrate (see paper)
30% identity, 95% coverage: 14:354/358 of query aligns to 15:339/341 of 1lluA
- active site: C43 (= C42), H44 (= H43), T45 (= T44), H48 (≠ D47), H66 (= H65), E67 (= E66), C97 (= C94), C100 (= C97), C103 (= C100), C111 (= C108), Q115 (≠ K112), C153 (≠ D156), T157 (= T160), R336 (= R351)
- binding 1,2-ethanediol: H44 (= H43), T45 (= T44), L47 (= L46), D53 (≠ G52), W92 (≠ V86), C153 (≠ D156)
- binding nicotinamide-adenine-dinucleotide: C43 (= C42), H44 (= H43), T45 (= T44), H48 (≠ D47), C153 (≠ D156), T157 (= T160), G179 (= G182), G180 (= G183), L181 (≠ V184), D200 (= D203), I201 (= I204), K205 (= K208), A243 (≠ E254), V244 (≠ C255), S245 (= S256), A248 (≠ V259), V265 (= V278), L267 (≠ Y280), I290 (≠ W303), V291 (vs. gap), R336 (= R351)
- binding zinc ion: C43 (= C42), H66 (= H65), C100 (= C97), C103 (= C100), C111 (= C108), C153 (≠ D156)
6iqdA Crystal structure of alcohol dehydrogenase from geobacillus stearothermophilus (see paper)
30% identity, 94% coverage: 20:354/358 of query aligns to 14:334/336 of 6iqdA
- active site: C38 (= C42), T40 (= T44), H43 (≠ D47), H61 (= H65), C148 (≠ D156)
- binding zinc ion: C38 (= C42), H61 (= H65), E62 (= E66), C92 (= C94), C95 (= C97), C98 (= C100), C106 (= C108), C148 (≠ D156)
3s2fE Crystal structure of furx nadh:furfural
28% identity, 95% coverage: 14:354/358 of query aligns to 12:336/340 of 3s2fE
- active site: C40 (= C42), H41 (= H43), T42 (= T44), H45 (≠ D47), H63 (= H65), E64 (= E66), C94 (= C94), C97 (= C97), C100 (= C100), C108 (= C108), Q112 (≠ K112), C150 (≠ D156), T154 (= T160), R333 (= R351)
- binding furfural: T42 (= T44), W51 (≠ V53), H63 (= H65), W89 (≠ V86), C150 (≠ D156), I287 (≠ V277)
- binding nicotinamide-adenine-dinucleotide: C40 (= C42), H41 (= H43), T42 (= T44), C150 (≠ D156), T154 (= T160), G174 (= G180), G176 (= G182), G177 (= G183), L178 (≠ V184), D197 (= D203), I198 (= I204), K202 (= K208), T239 (vs. gap), A240 (vs. gap), V241 (vs. gap), N262 (≠ S256), G263 (= G257), L264 (≠ S258), I287 (≠ V277), V288 (= V278), R333 (= R351)
- binding zinc ion: C40 (= C42), H63 (= H65), C94 (= C94), C97 (= C97), C100 (= C100), C108 (= C108), C150 (≠ D156)
3s2fA Crystal structure of furx nadh:furfural
28% identity, 95% coverage: 14:354/358 of query aligns to 12:336/340 of 3s2fA
- active site: C40 (= C42), H41 (= H43), T42 (= T44), H45 (≠ D47), H63 (= H65), E64 (= E66), C94 (= C94), C97 (= C97), C100 (= C100), C108 (= C108), Q112 (≠ K112), C150 (≠ D156), T154 (= T160), R333 (= R351)
- binding phosphorylisopropane: T42 (= T44), H63 (= H65), W89 (≠ V86), I287 (≠ V277)
- binding zinc ion: C40 (= C42), H63 (= H65), E64 (= E66), C94 (= C94), C97 (= C97), C100 (= C100), C108 (= C108), C150 (≠ D156)
3s2eE Crystal structure of furx nadh complex 1
28% identity, 95% coverage: 14:354/358 of query aligns to 12:336/340 of 3s2eE
- active site: C40 (= C42), H41 (= H43), T42 (= T44), H45 (≠ D47), H63 (= H65), E64 (= E66), C94 (= C94), C97 (= C97), C100 (= C100), C108 (= C108), Q112 (≠ K112), C150 (≠ D156), T154 (= T160), R333 (= R351)
- binding nicotinamide-adenine-dinucleotide: C40 (= C42), H41 (= H43), T42 (= T44), C150 (≠ D156), T154 (= T160), G176 (= G182), G177 (= G183), L178 (≠ V184), D197 (= D203), I198 (= I204), K202 (= K208), T239 (vs. gap), A240 (vs. gap), V241 (vs. gap), S242 (vs. gap), A245 (= A238), N262 (≠ S256), G263 (= G257), L264 (≠ S258), I287 (≠ V277), V288 (= V278)
- binding zinc ion: C40 (= C42), H63 (= H65), C94 (= C94), C97 (= C97), C100 (= C100), C108 (= C108), C150 (≠ D156)
3s2eA Crystal structure of furx nadh complex 1
28% identity, 95% coverage: 14:354/358 of query aligns to 12:336/340 of 3s2eA
- active site: C40 (= C42), H41 (= H43), T42 (= T44), H45 (≠ D47), H63 (= H65), E64 (= E66), C94 (= C94), C97 (= C97), C100 (= C100), C108 (= C108), Q112 (≠ K112), C150 (≠ D156), T154 (= T160), R333 (= R351)
- binding zinc ion: C40 (= C42), H63 (= H65), E64 (= E66), C94 (= C94), C97 (= C97), C100 (= C100), C108 (= C108), C150 (≠ D156)
P81600 Alcohol dehydrogenase class-3 chain H; Alcohol dehydrogenase class-III chain H; Glutathione-dependent formaldehyde dehydrogenase; FALDH; FDH; GSH-FDH; S-(hydroxymethyl)glutathione dehydrogenase; EC 1.1.1.1; EC 1.1.1.-; EC 1.1.1.284 from Gadus morhua (Atlantic cod) (see 2 papers)
29% identity, 95% coverage: 14:354/358 of query aligns to 18:373/375 of P81600
Sites not aligning to the query:
- 1 modified: N-acetylalanine
Q97YM2 D-arabinose 1-dehydrogenase (NADP(+)); AraDH; D-Ara dehydrogenase; EC 1.1.1.427 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
27% identity, 97% coverage: 9:356/358 of query aligns to 13:349/349 of Q97YM2
- C46 (= C42) binding
- H70 (= H65) binding
- D99 (≠ C94) binding
- C102 (= C97) binding
- C105 (= C100) binding
- C113 (= C108) binding
- D155 (= D156) binding
1h2bB Crystal structure of the alcohol dehydrogenase from the hyperthermophilic archaeon aeropyrum pernix at 1.65a resolution (see paper)
29% identity, 92% coverage: 28:356/358 of query aligns to 25:344/344 of 1h2bB
- active site: C39 (= C42), H40 (= H43), T41 (= T44), H44 (≠ Y48), H64 (= H65), E65 (= E66), D94 (≠ C94), C97 (= C97), C100 (= C100), C108 (= C108), E112 (≠ K112), D153 (= D156), T157 (= T160), R339 (= R351)
- binding nicotinamide-adenine-dinucleotide (acidic form): C39 (= C42), H40 (= H43), T41 (= T44), H44 (≠ Y48), T157 (= T160), V180 (≠ C181), G181 (= G182), G182 (= G183), L183 (≠ V184), D203 (= D203), V204 (≠ I204), K208 (= K208), F246 (≠ C255), V247 (≠ S256), T252 (≠ G261), Y255 (≠ S264), V269 (= V278), G270 (= G279), Y271 (= Y280), L293 (≠ A299), V294 (≠ L300), R339 (= R351)
- binding octanoic acid (caprylic acid): T41 (= T44), W50 (vs. gap), H64 (= H65), D153 (= D156), V294 (≠ L300)
- binding zinc ion: C39 (= C42), H64 (= H65), D94 (≠ C94), C97 (= C97), C100 (= C100), C108 (= C108), D153 (= D156)
6z42A The low resolution structure of a zinc-dependent alcohol dehydrogenase from halomonas elongata.
28% identity, 94% coverage: 15:350/358 of query aligns to 14:330/336 of 6z42A
- active site: C41 (= C42), T43 (= T44), H46 (≠ D47), H64 (= H65), C148 (≠ D156)
- binding zinc ion: C41 (= C42), H64 (= H65), E65 (= E66), C95 (= C94), C98 (= C97), C101 (= C100), C109 (= C108), C148 (≠ D156)
3meqA Crystal structure of alcohol dehydrogenase from brucella melitensis
27% identity, 95% coverage: 14:354/358 of query aligns to 12:338/341 of 3meqA
- active site: C40 (= C42), H41 (= H43), T42 (= T44), H45 (≠ D47), H63 (= H65), E64 (= E66), C94 (= C94), C97 (= C97), C100 (= C100), C108 (= C108), L112 (≠ K112), C150 (≠ D156), T154 (= T160), R335 (= R351)
- binding 1,4-dihydronicotinamide adenine dinucleotide: C40 (= C42), H41 (= H43), T42 (= T44), H45 (≠ D47), C150 (≠ D156), T154 (= T160), G176 (= G182), G177 (= G183), L178 (≠ V184), D197 (= D203), I198 (= I204), K202 (= K208), T241 (≠ C255), A242 (≠ S256), V243 (≠ G257), S244 (= S258), A247 (≠ G261), N264 (≠ V278), G265 (= G279), L266 (≠ Y280), I289 (≠ W303), V290 (vs. gap)
- binding zinc ion: C40 (= C42), H63 (= H65), C94 (= C94), C97 (= C97), C100 (= C100), C108 (= C108), C150 (≠ D156)
4eezB Crystal structure of lactococcus lactis alcohol dehydrogenase variant re1 (see paper)
32% identity, 93% coverage: 23:354/358 of query aligns to 20:336/342 of 4eezB
- active site: C39 (= C42), H40 (= H43), T41 (= T44), H44 (≠ Y48), H60 (= H65), E61 (= E66), C91 (= C94), C94 (= C97), C97 (= C100), C105 (= C108), K109 (= K112), C147 (≠ D156), T151 (= T160), R333 (= R351)
- binding zinc ion: C39 (= C42), H60 (= H65), E61 (= E66), C91 (= C94), C94 (= C97), C97 (= C100), C105 (= C108), C147 (≠ D156)
5k1sA Crystal structure of aibc (see paper)
28% identity, 94% coverage: 20:356/358 of query aligns to 32:356/358 of 5k1sA
- active site: C54 (= C42), Y55 (≠ H43), H56 (≠ T44), I59 (≠ L46), E77 (= E66), C106 (= C94), C109 (= C97), C112 (= C100), C120 (= C108), N124 (≠ Q111), C163 (≠ D156), T167 (= T160), R351 (= R351)
- binding zinc ion: C54 (= C42), H76 (= H65), C109 (= C97), C112 (= C100), C120 (= C108), C163 (≠ D156)
Query Sequence
>WP_043744206.1 NCBI__GCF_000009985.1:WP_043744206.1
MSISAYRWMMTGVGQPMVKEAMEIAAPGAGEVLVEVAGCGVCHTDLDYYYNGVRTNHALP
LALGHEISGRVIQAGAGAESWVGKAVIISAVIPCGQCDLCKRGKGTICRSQKMPGNDLQG
GFATHITVPANGLCAVDEARLKAAGLELSEVSVVADALTTPYQAAVQAGIGQGDLVIVIG
CGGVGGYSVQVASAMGATVVALDIDPVKLEAVKAAGAKLTLNPKDFPSTREIKKEIGAFA
KAQGLRSTEWIIMECSGSVPGQQSAFDLMVHGCTICVVGYTMNKAEFRLSNLMAFHARAL
GNWGCPPDLYPGALDLVLSGKINVKNFVERRPLDSINDTFAAVHDHKLSRRAVLCPNA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory