SitesBLAST
Comparing WP_043744649.1 NCBI__GCF_000009985.1:WP_043744649.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8c0zE Cryoem structure of a tungsten-containing aldehyde oxidoreductase from aromatoleum aromaticum (see paper)
52% identity, 99% coverage: 1:416/421 of query aligns to 1:413/424 of 8c0zE
6pfzA Structure of a NAD-dependent persulfide reductase from a. Fulgidus (see paper)
28% identity, 86% coverage: 19:378/421 of query aligns to 19:399/541 of 6pfzA
- active site: V37 (≠ P37), C42 (≠ M42)
- binding calcium ion: D306 (≠ I299), T332 (≠ M325)
- binding coenzyme a: R21 (≠ E21), S38 (≠ P38), G40 (≠ S40), C42 (≠ M42), K76 (≠ P63), R313 (= R306)
- binding flavin-adenine dinucleotide: E32 (≠ G32), A33 (≠ D33), R41 (= R41), C42 (≠ M42), A86 (≠ M79), A115 (= A105), T116 (≠ L106), G117 (= G107), L136 (≠ C126), G286 (= G279), D287 (= D280), P303 (≠ A296), F304 (≠ I297), G305 (≠ Q298)
Sites not aligning to the query:
3nt6A Structure of the shewanella loihica pv-4 nadh-dependent persulfide reductase c43s/c531s double mutant (see paper)
27% identity, 81% coverage: 39:378/421 of query aligns to 40:415/565 of 3nt6A
- active site: N42 (≠ R41), S43 (≠ M42), N325 (≠ A302)
- binding coenzyme a: N42 (≠ R41), S43 (≠ M42), A321 (≠ Q298), N325 (≠ A302), R329 (= R306)
- binding flavin-adenine dinucleotide: N42 (≠ R41), S43 (≠ M42), E80 (≠ R78), V81 (≠ M79), S112 (≠ A105), P113 (≠ L106), G114 (= G107), L133 (≠ C126), R134 (≠ W127), F161 (= F152), G302 (= G279), D303 (= D280), P319 (≠ A296), L320 (≠ I297), A321 (≠ Q298)
Sites not aligning to the query:
- active site: 11, 38, 471, 472
- binding coenzyme a: 11, 18, 19, 22, 39, 459, 462, 463, 466, 534, 535
- binding flavin-adenine dinucleotide: 7, 8, 10, 11, 12, 33, 34
8a56B Coenzyme a-persulfide reductase (coapr) from enterococcus faecalis (see paper)
26% identity, 95% coverage: 4:404/421 of query aligns to 4:410/539 of 8a56B
- binding flavin-adenine dinucleotide: I6 (≠ V6), G7 (= G7), V9 (≠ G9), G11 (≠ A11), E32 (≠ G32), K33 (≠ D33), C42 (≠ M42), V80 (≠ M79), S109 (≠ A105), P110 (≠ L106), G111 (= G107), I159 (≠ V153), G278 (= G279), D279 (= D280), S295 (≠ A296), L296 (≠ I297), A297 (≠ Q298)
- binding 3'-phosphate-adenosine-5'-diphosphate: T17 (≠ E17), R18 (≠ I18), R21 (≠ E21), F70 (≠ L69), R305 (= R306), I356 (vs. gap)
Sites not aligning to the query:
2yvjA Crystal structure of the ferredoxin-ferredoxin reductase (bpha3-bpha4)complex (see paper)
33% identity, 68% coverage: 4:290/421 of query aligns to 7:279/402 of 2yvjA
- active site: L13 (≠ P10), R44 (= R41), P45 (vs. gap)
- binding flavin-adenine dinucleotide: G10 (= G7), G12 (= G9), G35 (= G32), D36 (= D33), E37 (= E34), R44 (= R41), P45 (vs. gap), A78 (≠ M79), T105 (≠ L106), G106 (= G107), R126 (≠ W127), G268 (= G279), D269 (= D280)
- binding 1,4-dihydronicotinamide adenine dinucleotide: V147 (≠ M148), G148 (= G149), G149 (≠ A150), G150 (= G151), I152 (≠ V153), V170 (= V171), E171 (= E172), T172 (≠ M173), R179 (= R180), G230 (≠ S241), I231 (≠ A242), G232 (= G243), V233 (= V244)
Sites not aligning to the query:
2gr2A Crystal structure of ferredoxin reductase, bpha4 (oxidized form)
33% identity, 68% coverage: 4:290/421 of query aligns to 6:278/401 of 2gr2A
- active site: L12 (≠ P10), R43 (= R41), P44 (vs. gap)
- binding adenosine-5-diphosphoribose: R109 (≠ L111), V146 (≠ M148), G147 (= G149), G149 (= G151), V150 (≠ F152), I151 (≠ V153), E170 (= E172), T171 (≠ M173), R178 (= R180), G229 (≠ S241), I230 (≠ A242), G231 (= G243)
- binding flavin-adenine dinucleotide: G11 (= G9), A13 (= A11), D35 (= D33), E36 (= E34), R43 (= R41), P44 (vs. gap), K48 (≠ I44), A77 (≠ M79), T104 (≠ L106), G105 (= G107), R125 (≠ W127), G267 (= G279), D268 (= D280)
Sites not aligning to the query:
2gr0A Crystal structure of ferredoxin reductase, bpha4 (oxidized form, NAD+ complex) (see paper)
33% identity, 68% coverage: 4:290/421 of query aligns to 6:278/401 of 2gr0A
- active site: L12 (≠ P10), R43 (= R41), P44 (vs. gap)
- binding adenosine-5'-diphosphate: V146 (≠ M148), G147 (= G149), G149 (= G151), I151 (≠ V153), E170 (= E172), T171 (≠ M173), R178 (= R180), G229 (≠ S241), I230 (≠ A242), G231 (= G243)
- binding flavin-adenine dinucleotide: G11 (= G9), A13 (= A11), D35 (= D33), E36 (= E34), R43 (= R41), P44 (vs. gap), K48 (≠ I44), T76 (= T72), A77 (≠ M79), T104 (≠ L106), G105 (= G107), R125 (≠ W127), I151 (≠ V153), G267 (= G279), D268 (= D280)
Sites not aligning to the query:
8pxkA Structure of nadh-dependent ferredoxin reductase, bpha4, solved at wavelength 5.76 a (see paper)
33% identity, 68% coverage: 4:290/421 of query aligns to 8:280/403 of 8pxkA
- binding flavin-adenine dinucleotide: G13 (= G9), A15 (= A11), D37 (= D33), E38 (= E34), R45 (= R41), P46 (vs. gap), K50 (≠ I44), A79 (≠ M79), T106 (≠ L106), G107 (= G107), R127 (≠ W127), I153 (≠ V153), G269 (= G279), D270 (= D280)
Sites not aligning to the query:
1f3pA Ferredoxin reductase (bpha4)-nadh complex (see paper)
33% identity, 68% coverage: 4:290/421 of query aligns to 7:279/401 of 1f3pA
- active site: L13 (≠ P10), R44 (= R41), P45 (vs. gap)
- binding flavin-adenine dinucleotide: A14 (= A11), V34 (= V31), D36 (= D33), E37 (= E34), R44 (= R41), P45 (vs. gap), A78 (≠ M79), T105 (≠ L106), G106 (= G107), R126 (≠ W127), G268 (= G279), D269 (= D280)
- binding nicotinamide-adenine-dinucleotide: V147 (≠ M148), G148 (= G149), G150 (= G151), V151 (≠ F152), I152 (≠ V153), E155 (≠ I156), E171 (= E172), T172 (≠ M173), R179 (= R180), G230 (≠ S241), I231 (≠ A242), G232 (= G243), V233 (= V244)
Sites not aligning to the query:
4h4uA Crystal structure of ferredoxin reductase, bpha4 t176r mutant (reduced form)
33% identity, 68% coverage: 4:290/421 of query aligns to 7:279/401 of 4h4uA
- active site: L13 (≠ P10), R44 (= R41), P45 (vs. gap)
- binding flavin-adenine dinucleotide: G12 (= G9), A14 (= A11), D36 (= D33), R44 (= R41), P45 (vs. gap), A78 (≠ M79), T105 (≠ L106), G106 (= G107), L125 (≠ C126), R126 (≠ W127), I152 (≠ V153), E155 (≠ I156), G268 (= G279), D269 (= D280)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: V151 (≠ F152), I152 (≠ V153), E171 (= E172), R172 (≠ M173), Q173 (≠ G174), G230 (≠ S241), I231 (≠ A242), G232 (= G243)
Sites not aligning to the query:
4h4wA Crystal structure of ferredoxin reductase, bpha4 e175c/t176r/q177g mutant (reduced form)
33% identity, 68% coverage: 4:290/421 of query aligns to 6:278/399 of 4h4wA
- active site: L12 (≠ P10), R43 (= R41), P44 (vs. gap)
- binding flavin-adenine dinucleotide: G11 (= G9), A13 (= A11), D35 (= D33), R43 (= R41), P44 (vs. gap), A77 (≠ M79), T104 (≠ L106), G105 (= G107), R125 (≠ W127), I151 (≠ V153), E154 (≠ I156), G267 (= G279), D268 (= D280)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G148 (≠ A150), I151 (≠ V153), R171 (≠ M173), S177 (≠ P179), R178 (= R180), G229 (≠ S241), I230 (≠ A242), G231 (= G243)
Sites not aligning to the query:
3fg2P Crystal structure of ferredoxin reductase for the cyp199a2 system from rhodopseudomonas palustris (see paper)
31% identity, 76% coverage: 4:321/421 of query aligns to 5:316/404 of 3fg2P
- binding flavin-adenine dinucleotide: G8 (= G7), G10 (= G9), H11 (≠ P10), A12 (= A11), D34 (= D33), E35 (= E34), R42 (= R41), P43 (≠ M42), S46 (≠ P45), K47 (≠ Y46), R78 (= R78), M79 (= M79), T106 (≠ L106), R127 (≠ W127), I153 (≠ V153), D275 (= D280), S292 (≠ A296), V293 (≠ I297)
Sites not aligning to the query:
6rvhA Nadh-dependent coenzyme a disulfide reductase soaked with menadione (see paper)
29% identity, 71% coverage: 39:339/421 of query aligns to 41:340/443 of 6rvhA
- active site: C44 (≠ M42), E53 (≠ K51), E58 (≠ G56), Y159 (≠ F152), E163 (≠ I156)
- binding coenzyme a: Y41 (= Y39), C44 (≠ M42), R63 (≠ K61), N303 (≠ A302), R307 (= R306)
- binding flavin-adenine dinucleotide: A43 (≠ R41), C44 (≠ M42), V81 (≠ M79), T113 (≠ L106), G114 (= G107), R134 (≠ W127), Y159 (≠ F152), G280 (= G279), D281 (= D280), P297 (≠ A296), L298 (≠ I297), G299 (≠ Q298)
Sites not aligning to the query:
- active site: 39, 425, 430
- binding coenzyme a: 20, 23, 40, 359, 431, 437, 441, 442
- binding flavin-adenine dinucleotide: 8, 11, 12, 13, 34, 35, 424, 425
- binding menadione: 364, 365, 430, 431
6rvbA Nadh-dependent coenzyme a disulfide reductase soaked with nadh (see paper)
29% identity, 71% coverage: 39:339/421 of query aligns to 41:340/443 of 6rvbA
- active site: C44 (≠ M42), E53 (≠ K51), E58 (≠ G56), Y159 (≠ F152), E163 (≠ I156)
- binding coenzyme a: Y41 (= Y39), C44 (≠ M42), R63 (≠ K61), N303 (≠ A302), R307 (= R306)
- binding flavin-adenine dinucleotide: A43 (≠ R41), C44 (≠ M42), E80 (≠ R78), V81 (≠ M79), T113 (≠ L106), G114 (= G107), L133 (≠ C126), R134 (≠ W127), I160 (≠ V153), G280 (= G279), D281 (= D280), L298 (≠ I297), G299 (≠ Q298)
- binding nicotinamide-adenine-dinucleotide: G156 (= G149), G158 (= G151), Y159 (≠ F152), I160 (≠ V153), E179 (= E172), A180 (≠ M173), A240 (≠ S241), T241 (≠ A242), G242 (= G243), P297 (≠ A296), I328 (≠ V327), F329 (≠ L328)
Sites not aligning to the query:
- active site: 39, 425, 430
- binding coenzyme a: 15, 20, 23, 40, 359, 437, 441, 442
- binding flavin-adenine dinucleotide: 8, 11, 12, 13, 33, 34, 35, 36, 424, 425
6ruzA Nadh-dependent coenzyme a disulfide reductase (see paper)
29% identity, 71% coverage: 39:339/421 of query aligns to 41:340/443 of 6ruzA
- active site: C44 (≠ M42), E53 (≠ K51), E58 (≠ G56), Y159 (≠ F152), E163 (≠ I156)
- binding coenzyme a: Y41 (= Y39), C44 (≠ M42), R63 (≠ K61), N303 (≠ A302), R307 (= R306)
- binding flavin-adenine dinucleotide: A43 (≠ R41), C44 (≠ M42), E80 (≠ R78), V81 (≠ M79), T113 (≠ L106), G114 (= G107), A115 (= A108), L133 (≠ C126), R134 (≠ W127), Y159 (≠ F152), G280 (= G279), D281 (= D280), P297 (≠ A296), L298 (≠ I297), G299 (≠ Q298)
Sites not aligning to the query:
- active site: 39, 425, 430
- binding coenzyme a: 15, 19, 20, 23, 40, 359, 441, 442
- binding flavin-adenine dinucleotide: 8, 11, 12, 13, 33, 34, 35, 424, 425
6tukB Crystal structure of fdr9 (see paper)
32% identity, 66% coverage: 4:282/421 of query aligns to 5:262/393 of 6tukB
- binding flavin-adenine dinucleotide: V7 (= V6), G8 (= G7), G9 (≠ A8), G10 (= G9), A12 (= A11), A34 (≠ D33), E35 (= E34), R42 (= R41), P43 (≠ M42), K47 (≠ Y46), A75 (≠ R78), A76 (≠ M79), T102 (≠ L106), G103 (= G107), V118 (≠ C126), R119 (≠ W127), G259 (= G279), D260 (= D280)
Sites not aligning to the query:
P16640 Putidaredoxin reductase CamA; Pdr; Putidaredoxin--NAD(+) reductase; EC 1.18.1.5 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
31% identity, 67% coverage: 4:283/421 of query aligns to 8:287/422 of P16640
- A15 (= A11) binding
- D37 (= D33) binding
- K50 (≠ R41) binding
- V83 (≠ M79) binding
- R134 (≠ W127) binding
- D284 (= D280) binding
Sites not aligning to the query:
1q1wA Crystal structure of putidaredoxin reductase from pseudomonas putida (see paper)
31% identity, 67% coverage: 4:283/421 of query aligns to 7:286/422 of 1q1wA
- active site: L13 (≠ P10), L44 (vs. gap), P45 (= P37)
- binding flavin-adenine dinucleotide: G10 (= G7), G12 (= G9), L13 (≠ P10), A14 (= A11), G35 (= G32), D36 (= D33), L44 (vs. gap), P45 (= P37), K49 (≠ R41), V82 (≠ M79), A108 (= A105), T109 (≠ L106), G110 (= G107), R133 (≠ W127), I159 (≠ V153), D283 (= D280)
Sites not aligning to the query:
3cgeA Pyridine nucleotide complexes with bacillus anthracis coenzyme a- disulfide reductase: a structural analysis of dual NAD(p)h specificity (see paper)
25% identity, 90% coverage: 1:378/421 of query aligns to 1:394/444 of 3cgeA
- active site: A10 (≠ P10), Y37 (≠ P37), Q41 (≠ R41), C42 (≠ M42), N304 (≠ A302)
- binding coenzyme a: M17 (vs. gap), R21 (= R20), S38 (≠ P38), C42 (≠ M42), R61 (≠ K61), N304 (≠ A302), R308 (= R306)
- binding flavin-adenine dinucleotide: I6 (≠ V6), D9 (≠ G9), A10 (≠ P10), A11 (= A11), L31 (= L30), E32 (≠ V31), K33 (≠ G32), Q41 (≠ R41), C42 (≠ M42), V80 (≠ M79), T112 (≠ L106), G113 (= G107), G281 (= G279), D282 (= D280), I299 (= I297), G300 (≠ Q298), A303 (= A301)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: I156 (≠ M148), G157 (= G149), A160 (≠ F152), I161 (≠ V153), E164 (≠ Q165), E180 (≠ P179), R181 (= R180), N182 (vs. gap), T187 (vs. gap), V242 (≠ A242), G243 (= G243), P298 (≠ A296), I299 (= I297)
Sites not aligning to the query:
3cgdA Pyridine nucleotide complexes with bacillus anthracis coenzyme a- disulfide reductase: a structural analysis of dual NAD(p)h specificity (see paper)
25% identity, 90% coverage: 1:378/421 of query aligns to 1:394/444 of 3cgdA
- active site: A10 (≠ P10), Y37 (≠ P37), Q41 (≠ R41), C42 (≠ M42), N304 (≠ A302)
- binding coenzyme a: M17 (vs. gap), Q18 (≠ E17), R21 (= R20), S38 (≠ P38), Y39 (= Y39), C42 (≠ M42), R61 (≠ K61), N304 (≠ A302), R308 (= R306)
- binding flavin-adenine dinucleotide: I6 (≠ V6), G7 (= G7), D9 (≠ G9), A10 (≠ P10), A11 (= A11), L31 (= L30), E32 (≠ V31), K33 (≠ G32), Q41 (≠ R41), C42 (≠ M42), V80 (≠ M79), A111 (= A105), T112 (≠ L106), G281 (= G279), D282 (= D280), I299 (= I297), G300 (≠ Q298), A303 (= A301)
- binding nicotinamide-adenine-dinucleotide: I156 (≠ M148), G157 (= G149), G159 (= G151), A160 (≠ F152), I161 (≠ V153), E164 (≠ Q165), E180 (≠ P179), R181 (= R180), V242 (≠ A242), G243 (= G243), P298 (≠ A296), I299 (= I297)
Sites not aligning to the query:
Query Sequence
>WP_043744649.1 NCBI__GCF_000009985.1:WP_043744649.1
MHHLIVGAGPAGVTAAEIIRELEPGATITLVGDEPEPPYSRMAIPYMLVGKVGEDGTYLR
KGPNHYERLGITLMPGRRMSGLDPAARRIVLDGGETLAYDRLLLALGARPLRPDIEGLDL
PGIHTCWTLADARKIAAQAIPGSHVVLMGAGFVGTIVLEALALRQVSLTVVEMGDRMVPR
MMDETAGGMLKRWCEAKGVRVLTGTGIRRITQAQAAADTRDSLVVELSDGTSLPAHLVVV
SAGVRSNTEAVAASGIALGNGILVDDHMRTSLPDVFAAGDVAQGRDFMSGEAHVHAIQIT
AAAHGRIAAYNMTGNDQAYHGSLNMNVLDTLGLITCSFGSWQGNGGDCARLVDEAGFRYL
RLEFDGTSDVVIGAQAVGTTDHVGALRGLIQSKRRLGTAVKEQMMADPTRFMNGFVQILH
R
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory