Comparing WP_043744689.1 NCBI__GCF_000009985.1:WP_043744689.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7p9lAAA Ubiquitin-like protein SMT3,N-acetyl-D-glucosamine kinase
42% identity, 97% coverage: 2:290/297 of query aligns to 1:301/303 of 7p9lAAA
7p7wBBB Ubiquitin-like protein SMT3,N-acetyl-D-glucosamine kinase
42% identity, 97% coverage: 2:290/297 of query aligns to 4:304/306 of 7p7wBBB
7p9pAAA Ubiquitin-like protein SMT3,N-acetyl-D-glucosamine kinase
42% identity, 97% coverage: 2:290/297 of query aligns to 2:302/304 of 7p9pAAA
4db3A 1.95 angstrom resolution crystal structure of n-acetyl-d-glucosamine kinase from vibrio vulnificus.
36% identity, 97% coverage: 3:290/297 of query aligns to 9:307/311 of 4db3A
2ap1A Crystal structure of the putative regulatory protein
39% identity, 97% coverage: 3:290/297 of query aligns to 3:301/305 of 2ap1A
Q8ZPZ9 N-acetyl-D-glucosamine kinase; GlcNAc kinase; EC 2.7.1.59 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
39% identity, 97% coverage: 3:290/297 of query aligns to 1:299/303 of Q8ZPZ9
2qm1B Crystal structure of glucokinase from enterococcus faecalis
31% identity, 96% coverage: 5:290/297 of query aligns to 9:318/325 of 2qm1B
6jdoA Crystal structure of n-acetyl mannosmaine kinase with amp-pnp from pasteurella multocida
29% identity, 97% coverage: 5:293/297 of query aligns to 4:287/293 of 6jdoA
6jdhA Crystal structure of n-acetyl mannosmaine kinase from pasteurella multocida
29% identity, 97% coverage: 5:293/297 of query aligns to 4:287/293 of 6jdhA
1z05A Crystal structure of the rok family transcriptional regulator, homolog of e.Coli mlc protein.
26% identity, 92% coverage: 20:293/297 of query aligns to 93:383/396 of 1z05A
2gupA Structural genomics, the crystal structure of a rok family protein from streptococcus pneumoniae tigr4 in complex with sucrose
28% identity, 87% coverage: 7:264/297 of query aligns to 6:252/289 of 2gupA
Sites not aligning to the query:
P50456 DNA-binding transcriptional repressor Mlc; Making large colonies protein; Membrane linked control from Escherichia coli (strain K12) (see 4 papers)
27% identity, 71% coverage: 39:248/297 of query aligns to 126:346/406 of P50456
Sites not aligning to the query:
1z6rA Crystal structure of mlc from escherichia coli (see paper)
27% identity, 71% coverage: 39:248/297 of query aligns to 102:322/382 of 1z6rA
Q93LQ8 Beta-glucoside kinase; EC 2.7.1.85 from Klebsiella pneumoniae (see paper)
26% identity, 95% coverage: 7:289/297 of query aligns to 6:283/297 of Q93LQ8
3vglA Crystal structure of a rok family glucokinase from streptomyces griseus in complex with glucose and amppnp (see paper)
32% identity, 82% coverage: 3:247/297 of query aligns to 2:262/312 of 3vglA
Sites not aligning to the query:
3vgkB Crystal structure of a rok family glucokinase from streptomyces griseus (see paper)
32% identity, 82% coverage: 3:247/297 of query aligns to 2:262/312 of 3vgkB
3lm9A Crystal structure of fructokinase with adp and fructose bound in the active site (see paper)
29% identity, 68% coverage: 89:290/297 of query aligns to 86:284/294 of 3lm9A
Sites not aligning to the query:
1xc3A Structure of a putative fructokinase from bacillus subtilis (see paper)
29% identity, 68% coverage: 89:290/297 of query aligns to 86:284/295 of 1xc3A
P45425 N-acetylmannosamine kinase; ManNAc kinase; N-acetyl-D-mannosamine kinase; EC 2.7.1.60 from Escherichia coli (strain K12) (see paper)
32% identity, 92% coverage: 5:278/297 of query aligns to 4:275/291 of P45425
2aa4A Crystal structure of escherichia coli putative n-acetylmannosamine kinase, new york structural genomics consortium
32% identity, 92% coverage: 5:278/297 of query aligns to 4:275/289 of 2aa4A
>WP_043744689.1 NCBI__GCF_000009985.1:WP_043744689.1
MTLRIGIDLGGTKTEAIALDLSGRELARQRVATARGSYDGTIATIKGLVEGLESRLGAAA
SVGIGIPGTISPRTGLIKNANSTWLIGKPLDRDLETALGRPVRLANDADCFALSEATDGA
GAGFDTVFGVILGTGVGGGIVAHGRLLSGPNAIAGEWGHNPLPWPEDAERPGPACYCGRS
GCIETFLSGPGLARDHGGGLSAEQLATSDDAAAGAALARYERRLARALAAVINVIDPHVI
VLGGGLSKLDRLYRNVPALWEGFVFSDHVDTLLRPPRHGDSSGVRGAAWLWPATNNS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory