Comparing WP_043744857.1 NCBI__GCF_000009985.1:WP_043744857.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
6n2oC 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus with 2-oxoglutarate, coenzyme a and succinyl-coa bound (see paper)
23% identity, 96% coverage: 8:205/206 of query aligns to 7:185/572 of 6n2oC
Sites not aligning to the query:
6n2oA 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus with 2-oxoglutarate, coenzyme a and succinyl-coa bound (see paper)
23% identity, 96% coverage: 8:205/206 of query aligns to 7:185/572 of 6n2oA
Sites not aligning to the query:
6n2nA Crystal structure of 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus (see paper)
23% identity, 96% coverage: 8:205/206 of query aligns to 7:185/572 of 6n2nA
Sites not aligning to the query:
Q2RMD6 Pyruvate:ferredoxin oxidoreductase; PFOR; Pyruvate synthase; EC 1.2.7.1 from Moorella thermoacetica (strain ATCC 39073 / JCM 9320) (see paper)
26% identity, 68% coverage: 46:185/206 of query aligns to 456:598/1171 of Q2RMD6
Sites not aligning to the query:
6cipA Pyruvate:ferredoxin oxidoreductase from moorella thermoacetica with acetyl-tpp bound (see paper)
26% identity, 68% coverage: 46:185/206 of query aligns to 455:597/1165 of 6cipA
Sites not aligning to the query:
6cioA Pyruvate:ferredoxin oxidoreductase from moorella thermoacetica with lactyl-tpp bound (see paper)
26% identity, 68% coverage: 46:185/206 of query aligns to 455:597/1164 of 6cioA
Sites not aligning to the query:
6ciqA Pyruvate:ferredoxin oxidoreductase from moorella thermoacetica with coenzyme a bound (see paper)
26% identity, 68% coverage: 46:185/206 of query aligns to 455:597/1169 of 6ciqA
Sites not aligning to the query:
6cinB Crystal structure of pyruvate:ferredoxin oxidoreductase from moorella thermoacetica (see paper)
26% identity, 68% coverage: 46:185/206 of query aligns to 455:597/1169 of 6cinB
Sites not aligning to the query:
>WP_043744857.1 NCBI__GCF_000009985.1:WP_043744857.1
MTDVITNILVCGTGGQGVMTAAEILSQAAMARGLDCKKSEVAGMAQRGGVVTSHVRFGKR
VWSPVITPGTADILVAFEVAEGSRWADMLRPGGVAMVNTIRLVPPVVSAGLFKYPDDPVA
QMRAAGVTVYDFDAGAIARELGDLRLINTIMLGAIADYLPFPAAELEEQIVGRFRERKPA
MVEVNQKAFAAGRDAAGSAKAKTSAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory