SitesBLAST
Comparing WP_043745126.1 NCBI__GCF_000009985.1:WP_043745126.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
4r1lA Crystal structure of a putative acyl-coa ligase (bt_0428) from bacteroides thetaiotaomicron vpi-5482 at 2.42 a resolution
29% identity, 100% coverage: 2:406/407 of query aligns to 4:431/433 of 4r1lA
- binding adenosine-5'-diphosphate: A215 (≠ G206), E216 (= E207), P217 (≠ A208), S237 (≠ C227), F238 (≠ Y228), G239 (≠ A229), M240 (≠ T230), T241 (≠ A231), D305 (= D291), R329 (= R315), N340 (≠ F326)
- binding adenosine monophosphate: A215 (≠ G206), E216 (= E207), P217 (≠ A208), S237 (≠ C227), F238 (≠ Y228), G239 (≠ A229), M240 (≠ T230), T241 (≠ A231), D305 (= D291), R329 (= R315), N340 (≠ F326)
- binding coenzyme a: S136 (≠ C129), A164 (≠ I157), G165 (= G158), N166 (= N159), S167 (≠ T160), I185 (≠ T178), Y188 (≠ F181), K337 (= K323), T408 (≠ K384)
- binding zinc ion: C252 (≠ T240), H259 (vs. gap), C314 (≠ S300), C316 (= C302)
4r1mA Crystal structure of a putative acyl-coa ligase (bt_0428) from bacteroides thetaiotaomicron vpi-5482 at 2.48 a resolution
29% identity, 97% coverage: 2:396/407 of query aligns to 4:420/435 of 4r1mA
- binding adenosine monophosphate: A215 (≠ G206), E216 (= E207), P217 (≠ A208), N236 (≠ Q226), S237 (≠ C227), F238 (≠ Y228), G239 (≠ A229), M240 (≠ T230), T241 (≠ A231), D305 (= D291), R329 (= R315), I335 (≠ K321), N340 (≠ F326)
- binding zinc ion: C252 (≠ T240), H259 (vs. gap), C314 (≠ S300), C316 (= C302)
2y4oA Crystal structure of paak2 in complex with phenylacetyl adenylate (see paper)
31% identity, 96% coverage: 8:396/407 of query aligns to 9:418/433 of 2y4oA
- binding 5'-o-[hydroxy(phenylacetyl)phosphoryl]adenosine: F135 (= F130), F140 (≠ T135), A213 (≠ G206), E214 (= E207), P215 (≠ A208), I235 (≠ C227), G237 (≠ A229), L238 (≠ T230), S239 (≠ A231), P244 (vs. gap), D304 (= D291), R325 (= R315), I331 (≠ K321), N336 (≠ F326)
2y4oB Crystal structure of paak2 in complex with phenylacetyl adenylate (see paper)
31% identity, 96% coverage: 8:396/407 of query aligns to 9:418/432 of 2y4oB
- binding 5'-o-[hydroxy(phenylacetyl)phosphoryl]adenosine: F135 (= F130), F140 (≠ T135), G212 (≠ S205), A213 (≠ G206), E214 (= E207), P215 (≠ A208), I235 (≠ C227), G237 (≠ A229), L238 (≠ T230), S239 (≠ A231), P244 (vs. gap), D304 (= D291), R325 (= R315), I331 (≠ K321), N336 (≠ F326)
- binding magnesium ion: S204 (= S197), V228 (≠ L220)
2y27B Crystal structure of paak1 in complex with atp from burkholderia cenocepacia (see paper)
33% identity, 88% coverage: 6:363/407 of query aligns to 5:372/427 of 2y27B
- binding adenosine-5'-triphosphate: K65 (= K64), S90 (= S94), S91 (≠ P95), G92 (= G96), T93 (≠ P97), T94 (≠ I98), F138 (≠ T135), A211 (≠ G206), E212 (= E207), P213 (≠ A208), D232 (≠ Q226), I233 (≠ C227), Y234 (= Y228), G235 (≠ A229), L236 (≠ T230), S237 (≠ A231), D302 (= D291), I320 (≠ W312), R323 (= R315)
- binding magnesium ion: V200 (vs. gap), S202 (= S197), L204 (= L199), M226 (≠ L220), G227 (= G221), Q347 (≠ R338), L350 (≠ E341)
Sites not aligning to the query:
2y4nA Paak1 in complex with phenylacetyl adenylate (see paper)
33% identity, 88% coverage: 6:363/407 of query aligns to 5:370/426 of 2y4nA
- binding 5'-o-[hydroxy(phenylacetyl)phosphoryl]adenosine: Y131 (≠ F130), F136 (≠ T135), G138 (= G137), G208 (≠ S205), A209 (≠ G206), E210 (= E207), P211 (≠ A208), I231 (≠ C227), Y232 (= Y228), G233 (≠ A229), L234 (≠ T230), S235 (≠ A231), P240 (vs. gap), D300 (= D291), R321 (= R315)
- binding magnesium ion: V198 (vs. gap), S200 (= S197), Q345 (≠ R338), L348 (≠ E341)
Sites not aligning to the query:
6he0A Crystal structure of 2-hydroxyisobutyryl-coa ligase (hcl) in complex with 2-hib-amp and coa in the thioesterfication state (see paper)
28% identity, 96% coverage: 4:395/407 of query aligns to 25:451/477 of 6he0A
- binding [[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] 2-methyl-2-oxidanyl-propanoate: S241 (= S205), G242 (= G206), E243 (= E207), P244 (vs. gap), G267 (≠ Y228), S268 (≠ A229), M269 (≠ T230), A270 (= A231), D335 (= D291), I357 (≠ W312), N371 (≠ F326)
- binding adenosine monophosphate: G242 (= G206), E243 (= E207), P244 (vs. gap), C266 (= C227), G267 (≠ Y228), S268 (≠ A229), A270 (= A231), E271 (≠ D232), D335 (= D291), N371 (≠ F326)
- binding coenzyme a: Y166 (≠ H133), A188 (≠ I157), G189 (= G158), P191 (≠ T160), S194 (≠ Q163), Y210 (≠ G176), G211 (= G177), T212 (= T178), Y215 (≠ F181), H218 (≠ I184), R368 (≠ K323), G369 (= G324), M401 (≠ N355), V439 (≠ L383), R440 (≠ K384)
6hdyA Crystal structure of 2-hydroxyisobutyryl-coa ligase (hcl) in the postadenylation state in complex with s3-hb-amp (see paper)
28% identity, 96% coverage: 4:395/407 of query aligns to 25:447/474 of 6hdyA
- binding (3s)-3-hydroxybutanoic acid: Y162 (≠ H133), S237 (= S205), G263 (≠ Y228), S264 (≠ A229), M265 (≠ T230), A266 (= A231), F271 (vs. gap)
- binding [[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] (3~{S})-3-oxidanylbutanoate: Y162 (≠ H133), G164 (≠ T135), S237 (= S205), G238 (= G206), E239 (= E207), P240 (vs. gap), C262 (= C227), G263 (≠ Y228), S264 (≠ A229), A266 (= A231), F271 (vs. gap), D331 (= D291), I353 (≠ W312), R356 (= R315)
Sites not aligning to the query:
6hdxA Crystal structure of 2-hydroxyisobutyryl-coa ligase (hcl) in the postadenylation state in complex with r3-hib-amp (see paper)
28% identity, 96% coverage: 4:395/407 of query aligns to 25:447/474 of 6hdxA
- binding [[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] (2~{R})-2-methyl-3-oxidanyl-propanoate: Y162 (≠ H133), G164 (≠ T135), S237 (= S205), G238 (= G206), E239 (= E207), P240 (vs. gap), C262 (= C227), G263 (≠ Y228), S264 (≠ A229), A266 (= A231), F271 (vs. gap), D331 (= D291), I353 (≠ W312), R356 (= R315)
- binding (2r)-3-hydroxy-2-methylpropanoic acid: Y162 (≠ H133), G164 (≠ T135), S237 (= S205), G263 (≠ Y228), S264 (≠ A229), A266 (= A231), F271 (vs. gap)
Sites not aligning to the query:
Query Sequence
>WP_043745126.1 NCBI__GCF_000009985.1:WP_043745126.1
MTEFYDSLETRSTDEREAAQFEALPEQIALAKADSPAFARVLAEVDPASVTGRAALARLP
VTRKSELIDAQQADPPFASLIATPKSELRRVFASPGPIYDPEGWDNDWWRIARALYAAGF
RRGDLMHNCFSYHFTPGGVMFETGAHALGCPVFPAGIGNTDQQAKAVADLKPAGYGGTPS
FLKIILERAEEMGLDHSSLTKACVSGEALLPPLRQSLKDLGVDVTQCYATADLGLIAYET
KAREGLIVDEGVIVEIVRPGTGDPVPEGEVGEVVVTSFNQDYPLIRFATGDLSAILTGRS
PCGRTNMRLKGWMGRADQTTKIKGMFVHPRQIAEVAKRHPEVIRARLVVEKDGENDRLTL
NVETSATGLEAALKDSFQSLCKLKTEVAFVTPGGLPNDGIVIQDKRA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory