Comparing WP_043745147.1 NCBI__GCF_000009985.1:WP_043745147.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P05654 Aspartate carbamoyltransferase catalytic subunit; Aspartate transcarbamylase; ATCase; EC 2.1.3.2 from Bacillus subtilis (strain 168) (see paper)
42% identity, 97% coverage: 9:316/317 of query aligns to 2:299/304 of P05654
Sites not aligning to the query:
6pnzA The structure of the aspartate transcarbamoylase trimer from staphylococcus aureus complexed with pala at 2.27 resolution.
40% identity, 94% coverage: 10:308/317 of query aligns to 3:293/293 of 6pnzA
3r7fA Crystal structure of cp-bound aspartate transcarbamoylase from bacillus subtilis (see paper)
43% identity, 93% coverage: 9:303/317 of query aligns to 2:285/291 of 3r7fA
3r7dA Crystal structure of unliganded aspartate transcarbamoylase from bacillus subtilis (see paper)
43% identity, 93% coverage: 9:303/317 of query aligns to 2:285/291 of 3r7dA
3r7lA Crystal structure of pala-bound aspartate transcarbamoylase from bacillus subtilis (see paper)
43% identity, 93% coverage: 9:303/317 of query aligns to 2:285/290 of 3r7lA
4bjhB Crystal structure of the aquifex reactor complex formed by dihydroorotase (h180a, h232a) with dihydroorotate and aspartate transcarbamoylase with n-(phosphonacetyl)-l-aspartate (pala) (see paper)
38% identity, 94% coverage: 9:306/317 of query aligns to 2:289/291 of 4bjhB
3d6nB Crystal structure of aquifex dihydroorotase activated by aspartate transcarbamoylase (see paper)
38% identity, 94% coverage: 9:306/317 of query aligns to 2:289/291 of 3d6nB
5g1nE Aspartate transcarbamoylase domain of human cad bound to pala (see paper)
38% identity, 93% coverage: 9:303/317 of query aligns to 6:300/307 of 5g1nE
P08955 Multifunctional protein CAD; Carbamoyl phosphate synthetase 2-aspartate transcarbamylase-dihydroorotase; EC 6.3.5.5; EC 3.5.1.2; EC 6.3.4.16; EC 2.1.3.2; EC 3.5.2.3 from Mesocricetus auratus (Golden hamster) (see paper)
38% identity, 93% coverage: 9:303/317 of query aligns to 1924:2218/2225 of P08955
Sites not aligning to the query:
P27708 Multifunctional protein CAD; Carbamoyl phosphate synthetase 2-aspartate transcarbamylase-dihydroorotase; EC 6.3.5.5; EC 3.5.1.2; EC 6.3.4.16; EC 2.1.3.2; EC 3.5.2.3 from Homo sapiens (Human) (see 7 papers)
38% identity, 93% coverage: 9:303/317 of query aligns to 1924:2218/2225 of P27708
Sites not aligning to the query:
5g1pA Aspartate transcarbamoylase domain of human cad bound to carbamoyl phosphate (see paper)
37% identity, 93% coverage: 9:303/317 of query aligns to 3:285/292 of 5g1pA
8bplA Aspartate transcarbamoylase mutant (n2045c, r2238c) from chaetomium thermophilum cad-like bound to carbamoyl phosphate (see paper)
36% identity, 96% coverage: 4:306/317 of query aligns to 11:314/316 of 8bplA
4eknB Structure of the catalytic chain of methanococcus jannaschii aspartate transcarbamoylase in a hexagonal crystal form (see paper)
36% identity, 95% coverage: 9:309/317 of query aligns to 2:302/304 of 4eknB
6ys6B Arabidopsis aspartate transcarbamoylase complex with pala (see paper)
38% identity, 90% coverage: 22:306/317 of query aligns to 20:308/312 of 6ys6B
6ypoA Arabidopsis aspartate transcarbamoylase bound to ump (see paper)
38% identity, 90% coverage: 22:306/317 of query aligns to 20:308/312 of 6ypoA
6yvbC Arabidopsis aspartate transcarbamoylase complex with carbamoyl phosphate (see paper)
38% identity, 90% coverage: 22:306/317 of query aligns to 32:320/324 of 6yvbC
P49077 Aspartate carbamoyltransferase, chloroplastic; Aspartate transcarbamylase; ATCase; EC 2.1.3.2 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
38% identity, 90% coverage: 22:306/317 of query aligns to 98:386/390 of P49077
P07259 Multifunctional protein URA2; Pyrimidine-specific carbamoyl phosphate synthase-aspartate carbamoyl transferase; CPSase-ATCase; EC 6.3.5.5; EC 3.5.1.2; EC 6.3.4.16; EC 2.1.3.2 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
35% identity, 96% coverage: 2:306/317 of query aligns to 1904:2209/2214 of P07259
Sites not aligning to the query:
1ml4A The pala-liganded aspartate transcarbamoylase catalytic subunit from pyrococcus abyssi (see paper)
37% identity, 94% coverage: 9:306/317 of query aligns to 5:303/307 of 1ml4A
P20054 Multifunctional protein pyr1-3; EC 6.3.5.5; EC 3.5.1.2; EC 6.3.4.16; EC 2.1.3.2; EC 3.5.2.3 from Dictyostelium discoideum (Social amoeba)
33% identity, 97% coverage: 1:306/317 of query aligns to 1915:2220/2225 of P20054
Sites not aligning to the query:
>WP_043745147.1 NCBI__GCF_000009985.1:WP_043745147.1
MTDAAFPHRHLLGIQGLAPSEITSLLDLAEGYVEQNRSSDKRKNLLRGRTVINLFYENST
RTRTSFELAGKRLGADVINMQSAGSSVQKGETLIDTAMTLNAMHLDVLVVRHPDSGAVKL
LSEKVNCAVINGGDGSHEHPTQALLDALTIRRRKGKLSGLNVAICGDVRHSRVARSNIYL
LNAMGAHVRLIGPRTLLPSGLDRMGVEVFHDMRKGLADVDVIMMLRIQNERMSGNFIPSI
REYFHFFGLDREKLGIAKPDAVIMHPGPMNRGVEIDSDVADDVERSLIRSQVEMGVAVRM
ACLDMLTRDLTRSEGAV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory