Comparing WP_043745375.1 NCBI__GCF_000009985.1:WP_043745375.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
S5N020 Malyl-CoA/beta-methylmalyl-CoA/citramalyl-CoA lyase; (3S)-3-carboxy-3-hydroxypropanoyl-CoA glyoxylate-lyase; (3S)-citramalyl-CoA pyruvate-lyase; (S)-citramalyl-CoA lyase; Erythro-beta-methylmalyl-CoA; L-malyl-CoA lyase; EC 4.1.3.24; EC 4.1.3.25 from Chloroflexus aurantiacus (see paper)
72% identity, 98% coverage: 8:349/349 of query aligns to 7:348/348 of S5N020
4l80C Crystal structure of chloroflexus aurantiacus malyl-coa lyase in complex with magnesium, oxalate, and propionyl-coa (see paper)
72% identity, 98% coverage: 8:349/349 of query aligns to 6:347/347 of 4l80C
Q3J5L6 L-malyl-CoA/beta-methylmalyl-CoA lyase; (3S)-malyl-CoA/beta-methylmalyl-CoA lyase; (S)-citramalyl-CoA lyase; EC 4.1.3.24; EC 4.1.3.25 from Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.) (Rhodobacter sphaeroides) (see paper)
37% identity, 92% coverage: 18:338/349 of query aligns to 7:318/318 of Q3J5L6
4l9yC Crystal structure of rhodobacter sphaeroides malyl-coa lyase in complex with magnesium, glyoxylate, and propionyl-coa (see paper)
37% identity, 92% coverage: 18:337/349 of query aligns to 6:316/316 of 4l9yC
4l9yA Crystal structure of rhodobacter sphaeroides malyl-coa lyase in complex with magnesium, glyoxylate, and propionyl-coa (see paper)
38% identity, 91% coverage: 18:334/349 of query aligns to 6:313/314 of 4l9yA
4l9zA Crystal structure of rhodobacter sphaeroides malyl-coa lyase in complex with magnesium, oxalate, and coa (see paper)
38% identity, 91% coverage: 18:334/349 of query aligns to 5:312/313 of 4l9zA
5ugrA Malyl-coa lyase from methylobacterium extorquens (see paper)
36% identity, 90% coverage: 27:339/349 of query aligns to 11:323/323 of 5ugrA
5vxcA Crystal structure analysis of human clybl in complex with free coash (see paper)
26% identity, 89% coverage: 30:339/349 of query aligns to 7:301/301 of 5vxcA
Q8N0X4 Citramalyl-CoA lyase, mitochondrial; (3S)-malyl-CoA thioesterase; Beta-methylmalate synthase; Citrate lyase subunit beta-like protein; Citrate lyase beta-like; Malate synthase; EC 4.1.3.25; EC 3.1.2.30; EC 2.3.3.-; EC 2.3.3.9 from Homo sapiens (Human) (see 5 papers)
26% identity, 89% coverage: 30:339/349 of query aligns to 46:340/340 of Q8N0X4
5vxoA Crystal structure analysis of human clybl in complex with propionyl- coa (see paper)
26% identity, 88% coverage: 30:336/349 of query aligns to 7:298/298 of 5vxoA
Q9RUZ0 Citrate lyase subunit beta-like protein; EC 4.1.-.- from Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
25% identity, 88% coverage: 25:331/349 of query aligns to 4:281/284 of Q9RUZ0
1sgjB Crystal structure of citrate lyase beta subunit
26% identity, 75% coverage: 25:287/349 of query aligns to 1:230/231 of 1sgjB
1sgjA Crystal structure of citrate lyase beta subunit
26% identity, 75% coverage: 25:287/349 of query aligns to 1:230/231 of 1sgjA
3r4iA Crystal structure of a citrate lyase (bxe_b2899) from burkholderia xenovorans lb400 at 2.24 a resolution
23% identity, 67% coverage: 92:324/349 of query aligns to 79:297/321 of 3r4iA
>WP_043745375.1 NCBI__GCF_000009985.1:WP_043745375.1
MSVKPPRKFFEPLAIGAPAPYRELPVRLERMIHFFPPHNEKMRAKAAEMGKNVDVLLGNL
EDAIPADAKDAARAGFVEVAKAWDNPNTGLWTRVNCLNSPWFLDDMNAIVGEAGNKVDVV
MLPKVEGPWDIHYLDQLLAQLEAKHGVKRPIMIHAILETALGVENVAAICQASPRMHGIS
LGPADLAASRGMKTTRVGGGHPFYGVLEDAAEGKAGRTLFQQDLWHYTVAKMVDACQSAG
IKAFYGPFGDFSDDAACEAQFRNAFLLGCAGGWSLHPKQIDIAKKVFSPDVAEVLFAKKI
LEAMPDGTGAVMIDGKMQDDATWKQAKVMVDLAKAVAAKDPAMAQAYGL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory