SitesBLAST
Comparing WP_043745553.1 NCBI__GCF_000009985.1:WP_043745553.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2pqcA Cp4 epsps liganded with (r)-phosphonate tetrahedral reaction intermediate analog (see paper)
58% identity, 99% coverage: 2:439/444 of query aligns to 2:442/445 of 2pqcA
- active site: K23 (= K23), S24 (= S24), D50 (= D50), N93 (= N94), R123 (= R124), D321 (= D322), E349 (= E350), H399 (= H396), R400 (= R397), T426 (= T423)
- binding [3r-[3a,4a,5b(r*)]]-5-(1-carboxy-1-phosphonoethoxy)-4-hydroxy-3-(phosphonooxy)-1-cyclohexene-1-carboxylic acid: K23 (= K23), S24 (= S24), R28 (= R28), T96 (= T97), R123 (= R124), S168 (= S169), Q170 (= Q171), D321 (= D322), K348 (= K349), E349 (= E350), R352 (= R353), R400 (= R397)
2pqbA Cp4 epsps liganded with (r)-difluoromethyl tetrahedral intermediate analog (see paper)
58% identity, 99% coverage: 2:439/444 of query aligns to 2:442/445 of 2pqbA
- active site: K23 (= K23), S24 (= S24), D50 (= D50), N93 (= N94), R123 (= R124), D321 (= D322), E349 (= E350), H399 (= H396), R400 (= R397), T426 (= T423)
- binding (3r,4s,5r)-5-[(1r)-1-carboxy-2,2-difluoro-1-(phosphonooxy)ethoxy]-4-hydroxy-3-(phosphonooxy)cyclohex-1-ene-1-carboxylic acid: K23 (= K23), S24 (= S24), R28 (= R28), A95 (≠ G96), T96 (= T97), R123 (= R124), S168 (= S169), Q170 (= Q171), D321 (= D322), K348 (= K349), E349 (= E350), R352 (= R353), R400 (= R397)
2ggaA Cp4 epsp synthase liganded with s3p and glyphosate (see paper)
58% identity, 99% coverage: 2:439/444 of query aligns to 2:442/445 of 2ggaA
- active site: K23 (= K23), S24 (= S24), D50 (= D50), N93 (= N94), R123 (= R124), D321 (= D322), E349 (= E350), H399 (= H396), R400 (= R397), T426 (= T423)
- binding glyphosate: K23 (= K23), A94 (≠ S95), A95 (≠ G96), T96 (= T97), R123 (= R124), D321 (= D322), E349 (= E350), R352 (= R353), R400 (= R397)
- binding shikimate-3-phosphate: S24 (= S24), R28 (= R28), S168 (= S169), A169 (= A170), Q170 (= Q171), R195 (= R196), D321 (= D322), K348 (= K349)
2gg6A Cp4 epsp synthase liganded with s3p (see paper)
58% identity, 99% coverage: 2:439/444 of query aligns to 2:442/445 of 2gg6A
- active site: K23 (= K23), S24 (= S24), D50 (= D50), N93 (= N94), R123 (= R124), D321 (= D322), E349 (= E350), H399 (= H396), R400 (= R397), T426 (= T423)
- binding shikimate-3-phosphate: S24 (= S24), R28 (= R28), T96 (= T97), S168 (= S169), Q170 (= Q171), D321 (= D322), K348 (= K349)
Q9R4E4 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Agrobacterium sp. (strain CP4) (see 2 papers)
58% identity, 99% coverage: 2:439/444 of query aligns to 7:447/455 of Q9R4E4
- KS 28:29 (= KS 23:24) binding
- R33 (= R28) binding
- NAAT 98:101 (≠ NSGT 94:97) Phosphoenolpyruvate
- A100 (≠ G96) mutation to G: Confers resistance to glyphosate.
- R128 (= R124) binding
- K353 (= K349) binding
- R357 (= R353) binding
- R405 (= R397) binding
3slhD 1.70 angstrom resolution structure of 3-phosphoshikimate 1- carboxyvinyltransferase (aroa) from coxiella burnetii in complex with shikimate-3-phosphate and glyphosate
45% identity, 97% coverage: 13:441/444 of query aligns to 13:433/440 of 3slhD
- active site: K23 (= K23), S24 (= S24), D50 (= D50), N95 (= N94), R125 (= R124), D317 (= D322), E345 (= E350), H388 (= H396), R389 (= R397), T415 (= T423)
- binding glyphosate: K23 (= K23), G97 (= G96), T98 (= T97), R125 (= R124), Q171 (= Q171), D317 (= D322), E345 (= E350), R348 (= R353), H388 (= H396), R389 (= R397)
- binding shikimate-3-phosphate: S24 (= S24), R28 (= R28), S169 (= S169), Q171 (= Q171), R196 (= R196), D317 (= D322), K344 (= K349)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S24 (= S24), R28 (= R28), T98 (= T97), Q171 (= Q171), R196 (= R196), D317 (= D322), K344 (= K349)
Q83E11 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
45% identity, 97% coverage: 13:441/444 of query aligns to 11:431/438 of Q83E11
- KS 21:22 (= KS 23:24) binding
- R26 (= R28) binding
- NSGT 93:96 (= NSGT 94:97) Phosphoenolpyruvate
- R123 (= R124) binding
- D315 (= D322) active site, Proton acceptor
- K342 (= K349) binding
- R346 (= R353) binding
- R387 (= R397) binding
4egrA 2.50 angstrom resolution structure of 3-phosphoshikimate 1- carboxyvinyltransferase (aroa) from coxiella burnetii in complex with phosphoenolpyruvate
45% identity, 97% coverage: 13:441/444 of query aligns to 13:429/434 of 4egrA
- active site: K23 (= K23), S24 (= S24), D50 (= D50), N95 (= N94), R125 (= R124), D313 (= D322), E341 (= E350), H384 (= H396), R385 (= R397), T411 (= T423)
- binding phosphoenolpyruvate: K23 (= K23), G97 (= G96), T98 (= T97), R125 (= R124), D313 (= D322), E341 (= E350), R344 (= R353), R385 (= R397)
Q9S400 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) (see paper)
43% identity, 95% coverage: 13:435/444 of query aligns to 10:424/427 of Q9S400
1rf6A Structural studies of streptococcus pneumoniae epsp synthase in s3p- glp bound state (see paper)
43% identity, 95% coverage: 13:435/444 of query aligns to 10:424/427 of 1rf6A
- active site: K20 (= K23), S21 (= S24), D47 (= D50), N90 (= N94), D115 (≠ G119), R120 (= R124), D312 (= D322), E340 (= E350), H384 (= H396), R385 (= R397), T412 (= T423)
- binding glyphosate: K20 (= K23), G92 (= G96), T93 (= T97), R120 (= R124), Q168 (= Q171), D312 (= D322), E340 (= E350), R343 (= R353), H384 (= H396), R385 (= R397)
- binding shikimate-3-phosphate: S21 (= S24), R25 (= R28), S166 (= S169), Q168 (= Q171), R193 (= R196), I311 (= I321), D312 (= D322), K339 (= K349)
1rf4A Structural studies of streptococcus pneumoniae epsp synthase, tetrahedral intermediate bound state (see paper)
43% identity, 95% coverage: 13:435/444 of query aligns to 10:424/427 of 1rf4A
- active site: K20 (= K23), S21 (= S24), D47 (= D50), N90 (= N94), D115 (≠ G119), R120 (= R124), D312 (= D322), E340 (= E350), H384 (= H396), R385 (= R397), T412 (= T423)
- binding (3r,4s,5r)-5-{[(1r)-1-carboxy-2-fluoro-1-(phosphonooxy)ethyl]oxy}-4-hydroxy-3-(phosphonooxy)cyclohex-1-ene-1-carboxylic acid: K20 (= K23), S21 (= S24), R25 (= R28), G92 (= G96), T93 (= T97), R120 (= R124), S166 (= S169), A167 (= A170), Q168 (= Q171), R193 (= R196), D312 (= D322), K339 (= K349), E340 (= E350), R343 (= R353), H384 (= H396), R385 (= R397)
3nvsA 1.02 angstrom resolution crystal structure of 3-phosphoshikimate 1- carboxyvinyltransferase from vibrio cholerae in complex with shikimate-3-phosphate (partially photolyzed) and glyphosate
28% identity, 94% coverage: 13:430/444 of query aligns to 12:419/426 of 3nvsA
- active site: K22 (= K23), S23 (= S24), D49 (= D50), N94 (= N94), P119 (≠ G119), R124 (= R124), H128 (≠ R128), Q135 (≠ R135), Y142 (≠ S142), E144 (≠ D144), A247 (= A244), A255 (≠ L253), D314 (= D322), E342 (= E350), H386 (= H396), R387 (= R397), K412 (≠ T423)
- binding glyphosate: K22 (= K23), G96 (= G96), R124 (= R124), Q172 (≠ A170), D314 (= D322), E342 (= E350), R345 (= R353), H386 (= H396), R387 (= R397)
- binding magnesium ion: E123 (≠ S123), Q145 (≠ G145)
- binding shikimate-3-phosphate: K22 (= K23), S23 (= S24), R27 (= R28), T97 (= T97), S170 (≠ A168), S171 (= S169), Q172 (≠ A170), S198 (≠ R196), Y201 (vs. gap), D314 (= D322), N337 (≠ E345), K341 (= K349)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S23 (= S24), R27 (= R28), Q172 (≠ A170), Y201 (vs. gap), D314 (= D322), K341 (= K349)
Q9KRB0 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
28% identity, 94% coverage: 13:430/444 of query aligns to 12:419/426 of Q9KRB0
7tm6A Crystal structure of shikimate-3-phosphate and glyphosate bound 3- phosphoshikimate 1-carboxyvinyltransferase from klebsiella pneumoniae
29% identity, 97% coverage: 3:432/444 of query aligns to 1:419/426 of 7tm6A
- binding glyphosate: K21 (= K23), G95 (= G96), R123 (= R124), Q170 (≠ A170), D312 (= D322), E340 (= E350), R343 (= R353), H384 (= H396), R385 (= R397)
- binding shikimate-3-phosphate: S22 (= S24), R26 (= R28), T96 (= T97), S168 (≠ A168), S169 (= S169), Q170 (≠ A170), S196 (≠ R196), Y199 (vs. gap), D312 (= D322), N335 (≠ E345), K339 (= K349)
7tm5B Crystal structure of shikimate-3-phosphate bound 3-phosphoshikimate 1- carboxyvinyltransferase from klebsiella pneumoniae
29% identity, 97% coverage: 3:432/444 of query aligns to 2:420/427 of 7tm5B
- binding shikimate-3-phosphate: K22 (= K23), S23 (= S24), R27 (= R28), S169 (≠ A168), S170 (= S169), Q171 (≠ A170), S197 (≠ R196), Y200 (vs. gap), D313 (= D322), N336 (≠ E345), K340 (= K349)
P11043 3-phosphoshikimate 1-carboxyvinyltransferase, chloroplastic; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EC 2.5.1.19 from Petunia hybrida (Petunia) (see paper)
28% identity, 95% coverage: 13:433/444 of query aligns to 85:511/516 of P11043
- G173 (= G96) mutation to A: Resistance to glyphosate due to a lower affinity. Slight reduction in EPSP synthase activity.
P07547 Pentafunctional AROM polypeptide; EC 4.2.3.4; EC 2.5.1.19; EC 2.7.1.71; EC 4.2.1.10; EC 1.1.1.25 from Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans) (see 2 papers)
29% identity, 94% coverage: 20:435/444 of query aligns to 412:839/1583 of P07547
Sites not aligning to the query:
- 44:46 binding
- 81:84 binding
- 114:116 binding
- 119 binding
- 139:140 binding
- 161 binding
- 179:182 binding
- 190 binding
- 194 binding
- 271 binding
- 287 binding
2pq9A E. Coli epsps liganded with (r)-difluoromethyl tetrahedral reaction intermediate analog (see paper)
29% identity, 97% coverage: 3:432/444 of query aligns to 2:420/427 of 2pq9A
- active site: K22 (= K23), S23 (= S24), D49 (= D50), N94 (= N94), P119 (≠ G119), R124 (= R124), D313 (= D322), E341 (= E350), H385 (= H396), R386 (= R397), K411 (≠ T423)
- binding (3r,4s,5r)-5-[(1r)-1-carboxy-2,2-difluoro-1-(phosphonooxy)ethoxy]-4-hydroxy-3-(phosphonooxy)cyclohex-1-ene-1-carboxylic acid: K22 (= K23), S23 (= S24), R27 (= R28), G96 (= G96), T97 (= T97), R124 (= R124), S169 (≠ A168), S170 (= S169), Q171 (≠ A170), S197 (≠ R192), Y200 (≠ T195), D313 (= D322), N336 (≠ E345), K340 (= K349), R344 (= R353), H385 (= H396), R386 (= R397), K411 (≠ T423)
2aa9A Epsp synthase liganded with shikimate (see paper)
29% identity, 97% coverage: 3:432/444 of query aligns to 2:420/427 of 2aa9A
- active site: K22 (= K23), S23 (= S24), D49 (= D50), N94 (= N94), P119 (≠ G119), R124 (= R124), D313 (= D322), E341 (= E350), H385 (= H396), R386 (= R397), K411 (≠ T423)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: K22 (= K23), S23 (= S24), R27 (= R28), T97 (= T97), Q171 (≠ A170), Y200 (≠ T195), D313 (= D322), K340 (= K349)
1x8tA Epsps liganded with the (r)-phosphonate analog of the tetrahedral reaction intermediate (see paper)
29% identity, 97% coverage: 3:432/444 of query aligns to 2:420/427 of 1x8tA
- active site: K22 (= K23), S23 (= S24), D49 (= D50), N94 (= N94), P119 (≠ G119), R124 (= R124), D313 (= D322), E341 (= E350), H385 (= H396), R386 (= R397), K411 (≠ T423)
- binding [3r-[3a,4a,5b(r*)]]-5-(1-carboxy-1-phosphonoethoxy)-4-hydroxy-3-(phosphonooxy)-1-cyclohexene-1-carboxylic acid: K22 (= K23), S23 (= S24), R27 (= R28), T97 (= T97), S169 (≠ A168), S170 (= S169), Q171 (≠ A170), S197 (≠ R192), Y200 (≠ T195), D313 (= D322), N336 (≠ E345), K340 (= K349), R344 (= R353), H385 (= H396), R386 (= R397)
Query Sequence
>WP_043745553.1 NCBI__GCF_000009985.1:WP_043745553.1
MAKPLSSRRAAPLAGSAPVPGDKSISHRALMLGALAVGESVVTGLLEGDDVLRTAACMRA
LGAEVERRDDGSWRLFGRGVGGLMEPADVLDMGNSGTGARLLMGLVATHPFTCFFTGDGS
LRSRPMRRVIDPLSRMGARFVSRDGGRLPLAVTGTAQPTPITYELPVASAQVKSAIMLAG
LNTAGETTVIEREATRDHTELMLRNFGATVRVEDAEGGGRAITVVGFPELTGRPVVVPAD
PSSAAFPVVAALLVEGSEIRLPNVGTNPLRTGLYQTLLEMGADIRFDHPRDQAGEPVADL
VVRSSRLKGVDVPAERAPSMIDEYPILAVAAAFAEGTTRMRGLGELRVKESDRLAAMARG
LAACGVAVEEEKDALIVHGTGRIPDGDATVTTHFDHRIAMSFLVMGMASARPVAVDDSEA
IDTSFPAFVELMNGLGAKISGDNP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory