Comparing WP_043747124.1 NCBI__GCF_000009985.1:WP_043747124.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9SID3 Hydroxyacylglutathione hydrolase 2, mitochondrial; Glyoxalase II; Glx II; EC 3.1.2.6 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
42% identity, 100% coverage: 1:257/257 of query aligns to 68:324/324 of Q9SID3
2q42A Ensemble refinement of the protein crystal structure of glyoxalase ii from arabidopsis thaliana gene at2g31350 (see paper)
43% identity, 98% coverage: 6:257/257 of query aligns to 3:254/254 of 2q42A
8ewoA Crystal structure of putative glyoxylase ii from pseudomonas aeruginosa
42% identity, 99% coverage: 4:257/257 of query aligns to 3:259/259 of 8ewoA
1qh5B Human glyoxalase ii with s-(n-hydroxy-n-bromophenylcarbamoyl) glutathione (see paper)
39% identity, 98% coverage: 6:257/257 of query aligns to 3:255/260 of 1qh5B
1qh5A Human glyoxalase ii with s-(n-hydroxy-n-bromophenylcarbamoyl) glutathione (see paper)
39% identity, 98% coverage: 6:257/257 of query aligns to 3:255/260 of 1qh5A
1qh3A Human glyoxalase ii with cacodylate and acetate ions present in the active site (see paper)
39% identity, 98% coverage: 6:257/257 of query aligns to 3:255/260 of 1qh3A
Q16775 Hydroxyacylglutathione hydrolase, mitochondrial; Glyoxalase II; Glx II; EC 3.1.2.6 from Homo sapiens (Human) (see paper)
39% identity, 98% coverage: 6:257/257 of query aligns to 51:303/308 of Q16775
6rz0A Crystal structure of escherichia coli glyoxalase ii
42% identity, 98% coverage: 6:257/257 of query aligns to 3:251/251 of 6rz0A
O24496 Hydroxyacylglutathione hydrolase cytoplasmic; Glyoxalase II; Glx II; EC 3.1.2.6 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
36% identity, 96% coverage: 9:255/257 of query aligns to 6:254/258 of O24496
2qedA Crystal structure of salmonella thyphimurium lt2 glyoxalase ii (see paper)
38% identity, 98% coverage: 6:257/257 of query aligns to 4:252/252 of 2qedA
Q8ZRM2 Hydroxyacylglutathione hydrolase; Glyoxalase II; Glx II; EC 3.1.2.6 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
38% identity, 98% coverage: 6:257/257 of query aligns to 3:251/251 of Q8ZRM2
2p18A Crystal structure of the leishmania infantum glyoxalase ii (see paper)
34% identity, 89% coverage: 6:233/257 of query aligns to 15:267/283 of 2p18A
4ysbA Crystal structure of ethe1 from myxococcus xanthus (see paper)
34% identity, 63% coverage: 13:174/257 of query aligns to 11:172/225 of 4ysbA
O95571 Persulfide dioxygenase ETHE1, mitochondrial; Ethylmalonic encephalopathy protein 1; Hepatoma subtracted clone one protein; Sulfur dioxygenase ETHE1; EC 1.13.11.18 from Homo sapiens (Human) (see 4 papers)
34% identity, 67% coverage: 2:174/257 of query aligns to 21:197/254 of O95571
Sites not aligning to the query:
4chlB Human ethylmalonic encephalopathy protein 1 (hethe1) (see paper)
34% identity, 67% coverage: 2:174/257 of query aligns to 5:181/237 of 4chlB
2xf4A Crystal structure of salmonella enterica serovar typhimurium ycbl (see paper)
31% identity, 56% coverage: 29:172/257 of query aligns to 27:192/210 of 2xf4A
Q9C8L4 Persulfide dioxygenase ETHE1 homolog, mitochondrial; Glyoxalase II; Glx II; Sulfur dioxygenase ETHE1; EC 1.13.11.18 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
32% identity, 53% coverage: 40:174/257 of query aligns to 93:234/294 of Q9C8L4
2gcuA X-ray structure of gene product from arabidopsis thaliana at1g53580 (see paper)
32% identity, 53% coverage: 40:174/257 of query aligns to 44:185/244 of 2gcuA
5ve5A Crystal structure of persulfide dioxygenase rhodanese fusion protein with rhodanese domain inactivating mutation (c314s) from burkholderia phytofirmans in complex with glutathione (see paper)
31% identity, 63% coverage: 13:174/257 of query aligns to 14:178/350 of 5ve5A
Sites not aligning to the query:
2zziA Crystal structure of ttha1623 in a di-iron-bound form (see paper)
32% identity, 64% coverage: 25:189/257 of query aligns to 19:195/198 of 2zziA
>WP_043747124.1 NCBI__GCF_000009985.1:WP_043747124.1
MAKIIVEQIPVLSDNYVYLAHEPLGGATAAIDPAVSEPVLERLAARGWTLTHILNTHHHG
DHTGANLDLARRTGCAVVGAARDSERIPGITLEVSEGETFMLGHAAVTVLEVPGHTSGHV
AYWLADSHVLFCGDTLFSLGCGRLFEGTAEEMWASLKKLRDLPPDTLAYPAHEYTAGNGR
FARLVERDNGALKARLDEVERLRAHNRPTVPVRLADERAANPFLRADTAAIARAVGLEPG
TDPALVFAELRRRKDVF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory