Comparing WP_043878852.1 NCBI__GCF_000010525.1:WP_043878852.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9A3Q9 Omega-aminotransferase; Beta-alanine--pyruvate aminotransferase; EC 2.6.1.-; EC 2.6.1.18 from Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) (see paper)
55% identity, 96% coverage: 15:445/449 of query aligns to 8:435/439 of Q9A3Q9
Q9I700 Beta-alanine--pyruvate aminotransferase; Beta-A--Py AT; Beta-alanine--pyruvate transaminase; Omega-amino acid aminotransferase; Omega-amino acid AT; Omega-amino acid--pyruvate aminotransferase; Omega-APT; EC 2.6.1.18 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
49% identity, 95% coverage: 10:437/449 of query aligns to 11:436/448 of Q9I700
4b98A The structure of the omega aminotransferase from pseudomonas aeruginosa (see paper)
49% identity, 95% coverage: 10:437/449 of query aligns to 4:429/441 of 4b98A
4uhmA Characterization of a novel transaminase from pseudomonas sp. Strain aac (see paper)
49% identity, 95% coverage: 13:437/449 of query aligns to 1:423/435 of 4uhmA
3a8uX Crystal structure of omega-amino acid:pyruvate aminotransferase
49% identity, 97% coverage: 9:445/449 of query aligns to 2:441/441 of 3a8uX
5lhaA Amine transaminase crystal structure from an uncultivated pseudomonas species in the pmp-bound form
39% identity, 94% coverage: 19:441/449 of query aligns to 10:439/447 of 5lhaA
5lh9D Amine transaminase crystal structure from an uncultivated pseudomonas species in the plp-bound (internal aldimine) form
39% identity, 94% coverage: 19:441/449 of query aligns to 12:441/449 of 5lh9D
6gwiB The crystal structure of halomonas elongata amino-transferase (see paper)
34% identity, 100% coverage: 3:449/449 of query aligns to 2:446/450 of 6gwiB
3i5tA Crystal structure of aminotransferase prk07036 from rhodobacter sphaeroides kd131
37% identity, 92% coverage: 37:449/449 of query aligns to 27:438/444 of 3i5tA
Sites not aligning to the query:
7qx3A Structure of the transaminase tr2e2 with eos (see paper)
33% identity, 92% coverage: 36:447/449 of query aligns to 2:416/422 of 7qx3A
6s54A Transaminase from pseudomonas fluorescens (see paper)
36% identity, 92% coverage: 30:443/449 of query aligns to 24:446/453 of 6s54A
Sites not aligning to the query:
6io1B Crystal structure of a novel thermostable (s)-enantioselective omega- transaminase from thermomicrobium roseum (see paper)
37% identity, 90% coverage: 37:438/449 of query aligns to 33:436/448 of 6io1B
Sites not aligning to the query:
7ypmA Crystal structure of transaminase cc1012 complexed with plp and l- alanine (see paper)
35% identity, 92% coverage: 36:448/449 of query aligns to 31:447/454 of 7ypmA
7qx0B Transaminase structure of plurienzyme (tr2e2) in complex with plp (see paper)
32% identity, 97% coverage: 12:447/449 of query aligns to 6:437/443 of 7qx0B
7ypnD Crystal structure of transaminase cc1012 mutant m9 complexed with plp (see paper)
33% identity, 97% coverage: 12:448/449 of query aligns to 7:447/455 of 7ypnD
6fyqA The crystal structure of a new transaminase from the marine bacterium virgibacillus (see paper)
33% identity, 96% coverage: 13:445/449 of query aligns to 5:435/443 of 6fyqA
6g4dB Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp (see paper)
33% identity, 97% coverage: 13:447/449 of query aligns to 9:444/453 of 6g4dB
6g4fA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with pmp (see paper)
33% identity, 97% coverage: 13:447/449 of query aligns to 9:444/451 of 6g4fA
6g4eA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp and 6-aminohexanoate (6-aca) (see paper)
33% identity, 97% coverage: 13:447/449 of query aligns to 9:444/451 of 6g4eA
D6R3B6 Vanillin aminotransferase; Putative aminotransferase; pAMT; EC 2.6.1.119 from Capsicum frutescens (Cayenne pepper) (Tabasco pepper) (see paper)
31% identity, 95% coverage: 21:447/449 of query aligns to 15:446/459 of D6R3B6
>WP_043878852.1 NCBI__GCF_000010525.1:WP_043878852.1
MDQVTDTGALARQLNVDPYWAPFTSNRRFKADPSDRTMISAEGCYFTNANGVKLFDGSSG
LWCTPLGHSHPRIVEAVTKQVRSLDYAPSFQVASATTIQLAERVAEMAPEGLNRVFFANS
GSEAVDTALKIAMGYHRLTGNATRTRFIGREKGYHGVGFGGMSVGGIVANRKMFAPGMVN
GVDHLPHTYDQSKMAFSKGQPAWGAHLADELERIVALHDASTIAAVIVEPMQGSAGVIVP
PIGYLERLREICTKHGILLIFDEVITGFGRTGWAFAAQRLGVVPDMITFAKAITNGIIPM
GGVIARQEIYEAFMSGPPAAIEFCHGYTYSGHPMAAAAAHATLDVYEEEDLFGRVRALEP
LMEAEFHSLKGEPNVVDVRNFGLTAAVELSPSAAGPSMRALSIFEAGLKQGLYMRYTGES
LAFSPPFISTEQQIKDMVAILRKLIRDAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory