Comparing WP_043917498.1 NCBI__GCF_000877395.1:WP_043917498.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
7cagA Mycobacterium smegmatis lpqy-sugabc complex in the catalytic intermediate state (see paper)
29% identity, 90% coverage: 23:304/312 of query aligns to 3:277/285 of 7cagA
P94529 Arabinooligosaccharides transport system permease protein AraP from Bacillus subtilis (strain 168) (see paper)
28% identity, 89% coverage: 9:286/312 of query aligns to 9:286/313 of P94529
P02916 Maltose/maltodextrin transport system permease protein MalF from Escherichia coli (strain K12) (see 4 papers)
28% identity, 41% coverage: 176:304/312 of query aligns to 368:507/514 of P02916
Sites not aligning to the query:
4ki0F Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to maltohexaose (see paper)
28% identity, 40% coverage: 176:301/312 of query aligns to 353:489/490 of 4ki0F
Sites not aligning to the query:
>WP_043917498.1 NCBI__GCF_000877395.1:WP_043917498.1
MTDTPLRDVGPAAAAGPASQIRRRRSRRMKALFPYLLVAPAVIYLLGITLYPGIYAIIQS
FHAVKFGPWQPVGFDNYVRLMGDYQFWGALWNTFVIGSISLTLQCVLALILAFYAYRDPW
VQGWRIVFLVPMLFMPSAVAFIYKLSFLDARVFSDLLQRIGLIDGNLAIQSSVWGSRALL
ILADVWQWTPFLFIIFVAALQGQDEEVEEAARLDGASWFSIFWNISLPLMKPVIAVALIL
RGIDITTMFTNVFIITKGGPAFGTETISYFIYRTGFKFFNFGYASAASVVMLILTIIIAQ
VVVKRAFVSARN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory