Comparing WP_043920126.1 NCBI__GCF_000877395.1:WP_043920126.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
5bokA Ferredoxin component of 3-nitrotoluene dioxygenase from diaphorobacter sp. Strain ds2
30% identity, 91% coverage: 2:102/111 of query aligns to 2:101/102 of 5bokA
P0A185 Naphthalene 1,2-dioxygenase system, ferredoxin component from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
35% identity, 74% coverage: 22:103/111 of query aligns to 23:104/104 of P0A185
Sites not aligning to the query:
2qpzA Naphthalene 1,2-dioxygenase rieske ferredoxin (see paper)
35% identity, 74% coverage: 22:103/111 of query aligns to 22:103/103 of 2qpzA
Q17938 Cholesterol 7-desaturase; Cholesterol desaturase daf-36; Rieske oxygenase DAF-36/Neverland; DAF-36/NVD; EC 1.14.19.21 from Caenorhabditis elegans (see paper)
26% identity, 61% coverage: 19:86/111 of query aligns to 97:168/428 of Q17938
Sites not aligning to the query:
D0C9N6 Carnitine monooxygenase oxygenase subunit; Carnitine monooxygenase alpha subunit; EC 1.14.13.239 from Acinetobacter baumannii (strain ATCC 19606 / DSM 30007 / JCM 6841 / CCUG 19606 / CIP 70.34 / NBRC 109757 / NCIMB 12457 / NCTC 12156 / 81) (see paper)
28% identity, 93% coverage: 2:104/111 of query aligns to 43:156/371 of D0C9N6
Sites not aligning to the query:
2i7fA Sphingomonas yanoikuyae b1 ferredoxin (see paper)
38% identity, 68% coverage: 27:101/111 of query aligns to 27:100/102 of 2i7fA
>WP_043920126.1 NCBI__GCF_000877395.1:WP_043920126.1
MTWTDIGHIDEIPLRGARKVKTIGGCVAVFRTAEAEVFATGGSCPHKGGPLADGIVHDRK
VTCPLHNWVIDLTSGAVLGADDGQVPTYPVRVEEDGRLLIDLGELRLRRSA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory