Comparing WP_044621645.1 NCBI__GCF_000940995.1:WP_044621645.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
1kofA Crystal structure of gluconate kinase (see paper)
52% identity, 83% coverage: 7:162/189 of query aligns to 10:166/171 of 1kofA
1ko8A Crystal structure of gluconate kinase (see paper)
52% identity, 83% coverage: 7:162/189 of query aligns to 10:166/172 of 1ko8A
1ko5A Crystal structure of gluconate kinase (see paper)
52% identity, 83% coverage: 7:162/189 of query aligns to 10:166/172 of 1ko5A
>WP_044621645.1 NCBI__GCF_000940995.1:WP_044621645.1
MVGKSIIVMGVSASGKSTIGYELAQRIGGKFIDGDDLHPKANILKMAQGEPLNDQDREPW
LERIRDAAFSIESKNETGVIVCSALKKCYREQIREGNHNLAFLYLAGSQEVIRERIRLRQ
GHFMKENMIASQFAVLETPVDETDVITVDIDQSIAAILDSAVAALTEQADTKQAKTEQSM
PATTQEIIA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory