Comparing WP_046010019.1 NCBI__GCF_000967895.1:WP_046010019.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6rl5G The first crystal structure of the daba aminotransferase ectb in the ectoine biosynthesis pathway of the model organism chromohalobacter salexigens dsm 3034 (see paper)
58% identity, 96% coverage: 2:414/430 of query aligns to 3:418/422 of 6rl5G
O66442 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Aquifex aeolicus (strain VF5)
31% identity, 93% coverage: 11:409/430 of query aligns to 5:374/376 of O66442
2eh6A Crystal structure of acetylornithine aminotransferase from aquifex aeolicus vf5
31% identity, 93% coverage: 11:409/430 of query aligns to 4:373/375 of 2eh6A
1sffA Structure of gamma-aminobutyrate aminotransferase complex with aminooxyacetate (see paper)
29% identity, 92% coverage: 19:413/430 of query aligns to 23:422/425 of 1sffA
Sites not aligning to the query:
1sf2A Structure of e. Coli gamma-aminobutyrate aminotransferase (see paper)
29% identity, 92% coverage: 19:413/430 of query aligns to 23:422/425 of 1sf2A
Sites not aligning to the query:
P22256 4-aminobutyrate aminotransferase GabT; 5-aminovalerate transaminase; GABA aminotransferase; GABA-AT; Gamma-amino-N-butyrate transaminase; GABA transaminase; Glutamate:succinic semialdehyde transaminase; L-AIBAT; EC 2.6.1.19; EC 2.6.1.48 from Escherichia coli (strain K12) (see 2 papers)
29% identity, 92% coverage: 19:413/430 of query aligns to 24:423/426 of P22256
4ppmA Crystal structure of pige: a transaminase involved in the biosynthesis of 2-methyl-3-n-amyl-pyrrole (map) from serratia sp. Fs14 (see paper)
34% identity, 78% coverage: 21:356/430 of query aligns to 47:370/464 of 4ppmA
Sites not aligning to the query:
A0A0J9X1Q5 Aminotransferase PigE; EC 2.6.1.- from Serratia sp. (strain FS14) (see paper)
34% identity, 78% coverage: 21:356/430 of query aligns to 418:741/853 of A0A0J9X1Q5
1szkA The structure of gamma-aminobutyrate aminotransferase mutant: e211s (see paper)
29% identity, 92% coverage: 19:413/430 of query aligns to 23:422/425 of 1szkA
Sites not aligning to the query:
1wkhA Acetylornithine aminotransferase from thermus thermophilus hb8
31% identity, 90% coverage: 24:408/430 of query aligns to 25:383/387 of 1wkhA
Sites not aligning to the query:
1wkgA Acetylornithine aminotransferase from thermus thermophilus hb8
31% identity, 90% coverage: 24:408/430 of query aligns to 25:383/387 of 1wkgA
Sites not aligning to the query:
1vefA Acetylornithine aminotransferase from thermus thermophilus hb8
31% identity, 90% coverage: 24:408/430 of query aligns to 25:383/387 of 1vefA
Sites not aligning to the query:
8ht4B Crystal structure of acetylornithine aminotransferase complex with plp from corynebacterium glutamicum
30% identity, 91% coverage: 19:411/430 of query aligns to 18:389/390 of 8ht4B
Q5SHH5 [LysW]-aminoadipate semialdehyde transaminase; EC 2.6.1.118 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
31% identity, 90% coverage: 24:408/430 of query aligns to 33:391/395 of Q5SHH5
P50457 4-aminobutyrate aminotransferase PuuE; GABA aminotransferase; GABA-AT; Gamma-amino-N-butyrate transaminase; GABA transaminase; Glutamate:succinic semialdehyde transaminase; EC 2.6.1.19 from Escherichia coli (strain K12) (see paper)
30% identity, 90% coverage: 25:413/430 of query aligns to 29:421/421 of P50457
4uoxC Crystal structure of ygjg in complex with pyridoxal-5'-phosphate and putrescine (see paper)
28% identity, 89% coverage: 30:411/430 of query aligns to 74:447/456 of 4uoxC
Sites not aligning to the query:
P42588 Putrescine aminotransferase; PAT; PATase; Cadaverine transaminase; Diamine transaminase; Putrescine transaminase; Putrescine--2-oxoglutaric acid transaminase; Putrescine:2-OG aminotransferase; EC 2.6.1.82; EC 2.6.1.29 from Escherichia coli (strain K12) (see paper)
28% identity, 89% coverage: 30:411/430 of query aligns to 76:449/459 of P42588
4uoxA Crystal structure of ygjg in complex with pyridoxal-5'-phosphate and putrescine (see paper)
28% identity, 89% coverage: 30:411/430 of query aligns to 70:443/453 of 4uoxA
Sites not aligning to the query:
2ordA Crystal structure of acetylornithine aminotransferase (ec 2.6.1.11) (acoat) (tm1785) from thermotoga maritima at 1.40 a resolution
28% identity, 93% coverage: 11:412/430 of query aligns to 12:391/393 of 2ordA
Q9X2A5 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
28% identity, 93% coverage: 11:412/430 of query aligns to 4:383/385 of Q9X2A5
>WP_046010019.1 NCBI__GCF_000967895.1:WP_046010019.1
MKIFKEIESEVQSYARSFPCVFNRAKDEFMWDEEGNRYLDFLAGAGTLNYGHNNDHLKAN
LMKYIMEDGITHGLDMHTKAKGDFLNTFNEKILKPRDMEYMVQFTGPTGTNAVEAAMKLA
RNVTGQQNIVTFTNGFHGVSLGALSATGNSHHRDAAGVSLNGIHRMPFDGYLGDGIDTTE
YLDKVLSDSSSGINSPAAVLLETVQGEGGVNVASIEWLQNLEKVCRKHGLLLIVDDIQAG
CGRTGTFFSFEESGIKPDIITMSKSISGYGLPFAVVLMKPELDQWKPGEHNGTFRGNNLA
FVTAKDAIDHYWSDDVFSNEVKAKGEYVKEQLIDIVGQYGEGNFTNKGRGMFQGINCVNG
EIAAKITKKAFSKGMIIETSGADDQIVKLFCPLTITQENLEKGIEILRESIKEVCSKEGD
IPEEKLYFQD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory