Comparing WP_046157845.1 NCBI__GCF_000971335.1:WP_046157845.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
Q8ZND6 Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.222; EC 2.3.1.8 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
55% identity, 99% coverage: 2:689/693 of query aligns to 3:711/714 of Q8ZND6
1xcoD Crystal structure of a phosphotransacetylase from bacillus subtilis in complex with acetylphosphate (see paper)
47% identity, 45% coverage: 373:687/693 of query aligns to 10:324/325 of 1xcoD
6ioxA Crystal structure of porphyromonas gingivalis phosphotransacetylase in complex with acetyl-coa (see paper)
46% identity, 45% coverage: 373:687/693 of query aligns to 11:334/339 of 6ioxA
P38503 Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.8 from Methanosarcina thermophila (see 2 papers)
43% identity, 46% coverage: 369:687/693 of query aligns to 4:328/333 of P38503
Sites not aligning to the query:
2af3C Phosphotransacetylase from methanosarcina thermophila soaked with coenzyme a (see paper)
43% identity, 46% coverage: 369:687/693 of query aligns to 3:327/332 of 2af3C
6zngF Maeb full-length acetyl-coa bound state (see paper)
36% identity, 44% coverage: 383:688/693 of query aligns to 439:744/753 of 6zngF
Sites not aligning to the query:
P76558 NADP-dependent malic enzyme; NADP-ME; EC 1.1.1.40 from Escherichia coli (strain K12) (see paper)
31% identity, 47% coverage: 369:691/693 of query aligns to 430:758/759 of P76558
Sites not aligning to the query:
7t85A Crystal structure of the n-terminal domain of the phosphate acetyltransferase from escherichia coli
35% identity, 28% coverage: 2:197/693 of query aligns to 3:173/173 of 7t85A
3u9eB The crystal structure of a possible phosphate acetyl/butaryl transferase (from listeria monocytogenes egd-e) in complex with coa.
29% identity, 20% coverage: 531:669/693 of query aligns to 133:268/288 of 3u9eB
Sites not aligning to the query:
3uf6A The crystal structure of a possible phosphate acetyl/butaryl transferase (from listeria monocytogenes egd-e) in complex with cod (3'-dephosphocoenzyme a)
29% identity, 20% coverage: 531:669/693 of query aligns to 131:266/285 of 3uf6A
Sites not aligning to the query:
P29946 Cobyrinate a,c-diamide synthase; Cobyrinic acid a,c-diamide synthetase; EC 6.3.5.11 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
27% identity, 29% coverage: 2:200/693 of query aligns to 6:182/459 of P29946
Sites not aligning to the query:
>WP_046157845.1 NCBI__GCF_000971335.1:WP_046157845.1
MQTFFLAPTGFNAGLTSVTLGAIRSLEQAGLRVGFVKPIAQDTKDGEAERSTHFAQAICR
LNPPQPISMERVEHLLSQGQVDQLMEEVVSLFQQASQNVDVVIVEGLVPDQKQVFSTFLN
TKIARNLQAQTILVSSVKALNATEIAEQLEMNIQAFGAQTVSGYILNHVLPGADRAELAR
EVQESGNLKKAGLPLLGVIPYQQELLAPRTQDVARYLNANVVHAGQQANRRVRNMVVAAR
TAPNIVNLLKPGALIITPGEREDVVMATSMAAMNGVPLAGLLLTCDSEPDPRIQQLCQQA
FTGGLPVLATSLNSMETASALNAMSHQVPSDDLERMEKVIEHVAEFLDVSTLKQSVGEPR
EIRLPPPAFRFQLMEKARKANKRIVLPEGNEPRTIQAAAICQEKGIARCVLLGNRAEILQ
VAETQGVTLPESVEILDPNEIRGQYVGPMVELRKGKGLNEPMALAQLEDTVVLGTMMLAM
NEVDGLVSGAVHTTANTIRPALQLIKTAPGSSIVSSVFFMLMPEQVYVYGDCAVNPDPTA
EQLADIAIQSADSAVAFGITPRVAMISYSTGSSGSGSDVEKVREATRIAQEKRPDLLIDG
PMQYDAASVESVGRQKAPDSQVAGRATVFVFPDLNTGNTTYKAVQRSANVVSVGPMLQGL
RKPVNDLSRGALVDDIVYTIALTALQAEQTPAN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory