SitesBLAST
Comparing WP_047212724.1 NCBI__GCF_001931675.1:WP_047212724.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6b9uA Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from brucella melitensis complexed with nadh
48% identity, 99% coverage: 3:252/252 of query aligns to 2:244/244 of 6b9uA
- active site: G15 (= G16), S142 (= S142), L152 (= L152), Y155 (= Y155), K159 (= K159)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G11 (= G12), S14 (= S15), G15 (= G16), F16 (= F17), D35 (= D36), R36 (≠ L37), A57 (≠ G61), D58 (= D62), I59 (≠ V63), N85 (= N89), A86 (= A90), V140 (= V140), S142 (= S142), Y155 (= Y155), K159 (= K159), A187 (≠ I187), G188 (= G188), T190 (= T190), P191 (≠ G191), L192 (= L192), F196 (= F196)
4urfB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
39% identity, 99% coverage: 1:249/252 of query aligns to 1:244/248 of 4urfB
- active site: G16 (= G16), S142 (= S142), I152 (≠ L152), Y155 (= Y155), K159 (= K159)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: L210 (= L215), R211 (≠ G216), R212 (= R217)
- binding bicarbonate ion: I92 (≠ T92), G94 (≠ H94), R109 (= R109), R179 (= R179), S228 (= S233)
- binding nicotinamide-adenine-dinucleotide: G12 (= G12), G14 (= G14), N15 (≠ S15), G16 (= G16), I17 (≠ F17), D36 (= D36), I37 (≠ L37), D62 (= D62), T63 (≠ V63), N89 (= N89), A90 (= A90), G91 (= G91), I140 (≠ V140), Y155 (= Y155), K159 (= K159), P185 (= P185), A186 (≠ V186), I188 (≠ G188), T190 (= T190)
4urfA Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
39% identity, 99% coverage: 1:249/252 of query aligns to 1:244/248 of 4urfA
- active site: G16 (= G16), S142 (= S142), I152 (≠ L152), Y155 (= Y155), K159 (= K159)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: I92 (≠ T92), S93 (≠ T93), G94 (≠ H94), E95 (≠ R95), T97 (≠ K97), E101 (= E101), T103 (= T103), Q106 (≠ E106), R109 (= R109), S175 (≠ P175), G177 (≠ Q177)
- binding magnesium ion: S237 (≠ V242), Y238 (≠ C243)
- binding nicotinamide-adenine-dinucleotide: G12 (= G12), G14 (= G14), N15 (≠ S15), G16 (= G16), I17 (≠ F17), D36 (= D36), I37 (≠ L37), W41 (≠ G41), D62 (= D62), T63 (≠ V63), N89 (= N89), A90 (= A90), G91 (= G91), I140 (≠ V140), Y155 (= Y155), K159 (= K159), P185 (= P185), I188 (≠ G188), T190 (= T190)
4ureB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
39% identity, 99% coverage: 1:249/252 of query aligns to 1:244/248 of 4ureB
- active site: G16 (= G16), S142 (= S142), I152 (≠ L152), Y155 (= Y155), K159 (= K159)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: N15 (≠ S15), G16 (= G16), I17 (≠ F17), N89 (= N89), G91 (= G91), Y155 (= Y155), P185 (= P185), A186 (≠ V186)
7v0hG Crystal structure of putative glucose 1-dehydrogenase from burkholderia cenocepacia in complex with NADP and a potential reaction product
41% identity, 98% coverage: 2:249/252 of query aligns to 8:251/253 of 7v0hG
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G12), S20 (≠ G14), K21 (≠ S15), G22 (= G16), I23 (≠ F17), A43 (≠ D36), S44 (≠ L37), S45 (≠ N38), G68 (= G61), D69 (= D62), V70 (= V63), N96 (= N89), S97 (≠ A90), G98 (= G91), Y100 (≠ H94), I144 (≠ V140), S146 (= S142), Y159 (= Y155), K163 (= K159), P189 (= P185), G190 (vs. gap), M191 (vs. gap), I192 (≠ V186), T194 (≠ G188), G196 (≠ T190), T197 (≠ G191)
- binding (2R)-2-(hydroxymethyl)pentanedioic acid: S146 (= S142), Y159 (= Y155), M191 (vs. gap), I202 (≠ F196)
7djsD Crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with NAD
41% identity, 98% coverage: 3:249/252 of query aligns to 3:247/251 of 7djsD
- binding nicotinamide-adenine-dinucleotide: G12 (= G12), G16 (= G16), I17 (≠ F17), D36 (= D36), L37 (= L37), C61 (≠ G61), D62 (= D62), V63 (= V63), N89 (= N89), A90 (= A90), T140 (≠ V140), S142 (= S142), Y155 (= Y155), K159 (= K159), A186 (≠ V186), V187 (≠ I187)
8cxaA Crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from mycobacterium smegmatis with bound NAD
39% identity, 99% coverage: 1:249/252 of query aligns to 1:247/251 of 8cxaA
- binding nicotinamide-adenine-dinucleotide: G12 (= G12), Q15 (≠ S15), G16 (= G16), I17 (≠ F17), D36 (= D36), V63 (= V63), N89 (= N89), A91 (≠ G91), S94 (≠ T92), I142 (≠ V140), S143 (≠ A141), S144 (= S142), Y157 (= Y155), K161 (= K159), P187 (= P185), H188 (≠ T190), I190 (≠ L192), I194 (≠ F196)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
35% identity, 98% coverage: 3:249/252 of query aligns to 3:244/248 of 6ixmC
- active site: G16 (= G16), S142 (= S142), Y155 (= Y155), K159 (= K159)
- binding nicotinamide-adenine-dinucleotide: G12 (= G12), S15 (= S15), G16 (= G16), I17 (≠ F17), D36 (= D36), I37 (≠ L37), A61 (≠ G61), D62 (= D62), T63 (≠ V63), N89 (= N89), A90 (= A90), M140 (≠ V140), S142 (= S142), Y155 (= Y155), K159 (= K159), P185 (= P185), A186 (≠ V186), Y187 (≠ I187), I188 (≠ G188), L192 (= L192)
7krmC Putative fabg bound to nadh from acinetobacter baumannii
38% identity, 100% coverage: 1:252/252 of query aligns to 1:243/244 of 7krmC
- active site: G18 (= G16), S140 (= S142), Y155 (= Y155)
- binding nicotinamide-adenine-dinucleotide: G12 (= G12), S15 (= S15), G18 (= G16), I19 (≠ F17), D38 (= D36), L39 (= L37), A60 (≠ G61), N61 (≠ D62), V62 (= V63), N88 (= N89), V111 (= V113), S140 (= S142), Y155 (= Y155), K159 (= K159), I188 (≠ M193), T190 (≠ E195)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
39% identity, 98% coverage: 2:249/252 of query aligns to 4:241/244 of 4nbuB
- active site: G18 (= G16), N111 (= N114), S139 (= S142), Q149 (≠ L152), Y152 (= Y155), K156 (= K159)
- binding acetoacetyl-coenzyme a: D93 (≠ N96), K98 (≠ E101), S139 (= S142), N146 (≠ R149), V147 (≠ P150), Q149 (≠ L152), Y152 (= Y155), F184 (≠ I187), M189 (≠ L192), K200 (= K208)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G12), N17 (≠ S15), G18 (= G16), I19 (≠ F17), D38 (= D36), F39 (≠ L37), V59 (≠ G61), D60 (= D62), V61 (= V63), N87 (= N89), A88 (= A90), G89 (= G91), I90 (≠ T92), T137 (≠ V140), S139 (= S142), Y152 (= Y155), K156 (= K159), P182 (= P185), F184 (≠ I187), T185 (≠ G188), T187 (= T190), M189 (≠ L192)
1ahiA 7 alpha-hydroxysteroid dehydrogenase complexed with nadh and 7-oxo glycochenodeoxycholic acid (see paper)
39% identity, 99% coverage: 1:249/252 of query aligns to 7:249/255 of 1ahiA
- active site: G22 (= G16), S146 (= S142), M156 (≠ L152), Y159 (= Y155), K163 (= K159)
- binding glycochenodeoxycholic acid: S146 (= S142), A148 (= A144), N151 (≠ R147), Y159 (= Y155), A196 (≠ F196), V200 (≠ P200)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G18 (= G12), A21 (≠ S15), G22 (= G16), I23 (≠ F17), D42 (= D36), I43 (≠ L37), D68 (= D62), I69 (≠ V63), N95 (= N89), Y159 (= Y155), K163 (= K159), P189 (= P185), G190 (≠ T190), I192 (≠ L192), T194 (= T194), A196 (≠ F196)
Sites not aligning to the query:
P0AET8 7alpha-hydroxysteroid dehydrogenase; 7alpha-HSDH; NAD-dependent 7alpha-hydroxysteroid dehydrogenase; EC 1.1.1.159 from Escherichia coli (strain K12) (see 2 papers)
39% identity, 99% coverage: 1:249/252 of query aligns to 7:249/255 of P0AET8
- I23 (≠ F17) binding NAD(+)
- DI 42:43 (≠ DL 36:37) binding NAD(+)
- DI 68:69 (≠ DV 62:63) binding NAD(+)
- N95 (= N89) binding NAD(+)
- G99 (≠ T93) binding glycochenodeoxycholate
- S146 (= S142) binding glycochenodeoxycholate; mutation S->A,H: Reduction of the catalytic efficiency by over 65%. No effect on the affinity for cholate and NAD.
- N151 (≠ R147) binding glycochenodeoxycholate
- Y159 (= Y155) binding glycochenodeoxycholate; binding NAD(+); mutation to F: Loss of activity.; mutation to H: Reduction of the catalytic efficiency by 87.7%. No effect on the affinity for cholate and NAD.
- K163 (= K159) binding NAD(+); mutation to I: Reduction of the catalytic efficiency by 95%. No effect on the affinity for cholate and NAD.; mutation to R: Reduction of the catalytic efficiency by 35%. No effect on the affinity for cholate and NAD.
- ILT 192:194 (≠ LMT 192:194) binding NAD(+)
1ahhA 7 alpha-hydroxysteroid dehydrogenase complexed with NAD+ (see paper)
39% identity, 99% coverage: 1:249/252 of query aligns to 7:249/253 of 1ahhA
- active site: G22 (= G16), S146 (= S142), M156 (≠ L152), Y159 (= Y155), K163 (= K159)
- binding nicotinamide-adenine-dinucleotide: G18 (= G12), A21 (≠ S15), D42 (= D36), I43 (≠ L37), C67 (≠ G61), D68 (= D62), I69 (≠ V63), N95 (= N89), G97 (= G91), T145 (≠ A141), Y159 (= Y155), K163 (= K159), P189 (= P185), G190 (≠ T190), I192 (≠ L192)
4wecA Crystal structure of a short chain dehydrogenase from mycobacterium smegmatis
40% identity, 98% coverage: 2:249/252 of query aligns to 7:249/258 of 4wecA
- active site: G21 (= G16), S143 (= S142), Q154 (≠ L152), Y157 (= Y155), K161 (= K159)
- binding nicotinamide-adenine-dinucleotide: G17 (= G12), A19 (≠ G14), S20 (= S15), G21 (= G16), I22 (≠ F17), D41 (= D36), I42 (≠ L37), V61 (≠ G61), D62 (= D62), V63 (= V63), N89 (= N89), T141 (≠ V140), Y157 (= Y155), K161 (= K159), P187 (= P185), P189 (≠ I187), V190 (≠ G188)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
38% identity, 100% coverage: 1:252/252 of query aligns to 1:247/247 of 4jroC
- active site: G16 (= G16), S142 (= S142), Q152 (≠ L152), Y155 (= Y155), K159 (= K159)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G12), S14 (≠ G14), R15 (≠ S15), G16 (= G16), I17 (≠ F17), N35 (= N35), Y36 (vs. gap), N37 (≠ D36), G38 (≠ L37), S39 (≠ N38), N63 (≠ D62), V64 (= V63), N90 (= N89), A91 (= A90), I93 (≠ T92), I113 (≠ V113), S142 (= S142), Y155 (= Y155), K159 (= K159), P185 (= P185), I188 (≠ M193), T190 (≠ E195)
8y83A Crystal structure of a ketoreductase from sphingobacterium siyangense sy1 with co-enzyme (see paper)
34% identity, 98% coverage: 3:249/252 of query aligns to 4:245/249 of 8y83A
- binding nicotinamide-adenine-dinucleotide: G13 (= G12), S16 (= S15), G17 (= G16), I18 (≠ F17), D37 (= D36), I38 (≠ L37), A62 (≠ G61), D63 (= D62), S64 (≠ V63), N90 (= N89), M141 (≠ V140), Y156 (= Y155), K160 (= K159), P186 (= P185), G187 (≠ V186), Y188 (≠ I187), I189 (≠ G188), L193 (= L192)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
37% identity, 97% coverage: 6:249/252 of query aligns to 5:243/246 of 3osuA
8w0oA Gdh-105 crystal structure
34% identity, 99% coverage: 3:252/252 of query aligns to 5:252/259 of 8w0oA
- binding nicotinamide-adenine-dinucleotide: G14 (= G12), S17 (= S15), G18 (= G16), L19 (≠ F17), Y39 (≠ L37), Q43 (≠ E40), D65 (= D62), V66 (= V63), N92 (= N89), A93 (= A90), G94 (= G91), M143 (≠ V140), Y158 (= Y155), K162 (= K159), P188 (= P185), G189 (≠ V186), I191 (≠ G188), T193 (= T190)
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
37% identity, 97% coverage: 6:249/252 of query aligns to 2:236/239 of 3sj7A
- active site: G12 (= G16), S138 (= S142), Q148 (≠ L152), Y151 (= Y155), K155 (= K159)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G12), S10 (≠ G14), R11 (≠ S15), I13 (≠ F17), N31 (= N35), Y32 (≠ D36), A33 (≠ L37), G34 (vs. gap), S35 (≠ N38), A58 (≠ G61), N59 (≠ D62), V60 (= V63), N86 (= N89), A87 (= A90), T109 (≠ V113), S138 (= S142), Y151 (= Y155), K155 (= K159), P181 (= P185), G182 (= G191)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
34% identity, 99% coverage: 1:249/252 of query aligns to 3:251/255 of 5itvA
- active site: G18 (= G16), S141 (= S142), Y154 (= Y155), K158 (= K159)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G12), S17 (= S15), G18 (= G16), I19 (≠ F17), D38 (= D36), I39 (≠ L37), T61 (≠ G61), I63 (≠ V63), N89 (= N89), G91 (= G91), T139 (≠ V140), S141 (= S142), Y154 (= Y155), K158 (= K159), P184 (= P185), G185 (= G198), I186 (≠ M199), I187 (≠ P200)
Query Sequence
>WP_047212724.1 NCBI__GCF_001931675.1:WP_047212724.1
MRLAGKTAIVTGAGSGFGEGIAATFAREGANVVVNDLNREGGQRVADAINAAGGKAAFVY
GDVSQSADTQGLLDAALSHFGRLDIVVNNAGTTHRNKPLLEITEAEFDRVYAVNVKSIFW
SARHMVPYFRQQGGGCIINVASTAGVRPRPGLVWYNGSKGAVIIASKAMAAELGPDQIRV
NCVNPVIGETGLMTEFMGMPDTPENRKKFLAGIPLGRFSKPQDIANACLYLASDDAEFIT
GVCLEVDGGRCI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory