Comparing WP_047215506.1 NCBI__GCF_001931675.1:WP_047215506.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
57% identity, 100% coverage: 1:241/241 of query aligns to 2:241/241 of 4u00A
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
55% identity, 100% coverage: 1:240/241 of query aligns to 1:240/240 of 4ymuJ
3c4jA Abc protein artp in complex with atp-gamma-s
53% identity, 100% coverage: 1:240/241 of query aligns to 3:242/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
53% identity, 100% coverage: 1:240/241 of query aligns to 3:242/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
53% identity, 100% coverage: 1:240/241 of query aligns to 3:242/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
53% identity, 100% coverage: 1:240/241 of query aligns to 3:242/242 of 2oljA
P02915 Histidine/lysine/arginine/ornithine transport ATP-binding protein HisP; EC 7.4.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
47% identity, 96% coverage: 6:236/241 of query aligns to 11:253/258 of P02915
1b0uA Atp-binding subunit of the histidine permease from salmonella typhimurium (see paper)
47% identity, 96% coverage: 6:236/241 of query aligns to 7:249/258 of 1b0uA
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
38% identity, 100% coverage: 1:241/241 of query aligns to 1:246/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
38% identity, 100% coverage: 1:241/241 of query aligns to 2:247/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
38% identity, 100% coverage: 1:241/241 of query aligns to 2:247/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
38% identity, 100% coverage: 1:241/241 of query aligns to 2:247/344 of 6cvlD
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
38% identity, 91% coverage: 1:220/241 of query aligns to 3:226/226 of 5xu1B
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
36% identity, 91% coverage: 1:220/241 of query aligns to 3:222/223 of 2pclA
P0AAH0 Phosphate import ATP-binding protein PstB; ABC phosphate transporter; Phosphate-transporting ATPase; EC 7.3.2.1 from Escherichia coli (strain K12) (see paper)
35% identity, 98% coverage: 2:237/241 of query aligns to 11:253/257 of P0AAH0
Sites not aligning to the query:
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
37% identity, 90% coverage: 19:236/241 of query aligns to 44:263/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
37% identity, 90% coverage: 19:236/241 of query aligns to 44:263/382 of 7aheC
Sites not aligning to the query:
8i6rB Cryo-em structure of pseudomonas aeruginosa ftse(e163q)x/envc complex with atp in peptidisc (see paper)
35% identity, 90% coverage: 1:217/241 of query aligns to 1:218/222 of 8i6rB
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
38% identity, 89% coverage: 1:214/241 of query aligns to 1:223/232 of 1f3oA
7ahdC Opua (e190q) occluded (see paper)
37% identity, 87% coverage: 19:227/241 of query aligns to 44:254/260 of 7ahdC
Sites not aligning to the query:
>WP_047215506.1 NCBI__GCF_001931675.1:WP_047215506.1
MIAMENVSKWYGQFKVLDNCTAQVGKGEVVVVCGPSGSGKSTLIKTVNGLEQYQQGRITV
DGVELGAPSIKLTQLRARVGMVFQHFELFPHLSILDNLTLAQIKVLKRGKEEARLKGLAL
LERVGLREHAPKYPAQLSGGQQQRVAIARALSMDPIAMLFDEPTSALDPEMINEVLDVMV
ELAREGMTMICVTHEMGFAKKVAHRVIFMDGGAIVEDACKDAFFGTPNSPRAREFLAKIL
H
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory