SitesBLAST
Comparing WP_047215942.1 NCBI__GCF_001931675.1:WP_047215942.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
5odcC Heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus at 2.3 a resolution (see paper)
30% identity, 24% coverage: 11:107/407 of query aligns to 19:109/184 of 5odcC
- binding iron/sulfur cluster: C34 (= C25), Y35 (≠ V26), Q36 (≠ H27), C37 (= C28), G38 (= G29), C40 (= C31), C44 (= C35), P45 (= P36), Y52 (≠ P48), T54 (≠ G50), C77 (= C75), T78 (≠ L76), T79 (= T77), C80 (= C78), Y81 (≠ R79), C83 (= C81), C87 (= C85), P88 (= P86), V91 (= V89)
Q007T0 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial; Iron-sulfur subunit of complex II; Ip; EC 1.3.5.1 from Sus scrofa (Pig) (see paper)
30% identity, 21% coverage: 22:107/407 of query aligns to 183:279/280 of Q007T0
- C186 (= C25) binding [4Fe-4S] cluster
- C189 (= C28) binding [4Fe-4S] cluster
- C192 (= C31) binding [4Fe-4S] cluster
- C196 (= C35) binding [3Fe-4S] cluster
- W201 (≠ L40) binding a ubiquinone
- C243 (= C75) binding [3Fe-4S] cluster
- C249 (= C81) binding [3Fe-4S] cluster
- C253 (= C85) binding [4Fe-4S] cluster
Sites not aligning to the query:
- 93 binding [2Fe-2S] cluster
- 98 binding [2Fe-2S] cluster
- 101 binding [2Fe-2S] cluster
- 113 binding [2Fe-2S] cluster
5odcI Heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus at 2.3 a resolution (see paper)
30% identity, 24% coverage: 11:107/407 of query aligns to 19:109/173 of 5odcI
- binding magnesium ion: R53 (= R49), D73 (≠ H71)
- binding iron/sulfur cluster: C34 (= C25), Y35 (≠ V26), Q36 (≠ H27), C37 (= C28), G38 (= G29), C40 (= C31), C44 (= C35), P45 (= P36), Y52 (≠ P48), T54 (≠ G50), C77 (= C75), T78 (≠ L76), T79 (= T77), C80 (= C78), Y81 (≠ R79), C83 (= C81), C87 (= C85), V91 (= V89)
Q9YHT2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial; Iron-sulfur subunit of complex II; Ip; EC 1.3.5.1 from Gallus gallus (Chicken) (see 2 papers)
28% identity, 21% coverage: 22:105/407 of query aligns to 193:284/290 of Q9YHT2
- C196 (= C25) binding [4Fe-4S] cluster
- C199 (= C28) binding [4Fe-4S] cluster
- C202 (= C31) binding [4Fe-4S] cluster
- C206 (= C35) binding [3Fe-4S] cluster
- W211 (≠ L40) binding a ubiquinone
- C253 (= C75) binding [3Fe-4S] cluster
- C259 (= C81) binding [3Fe-4S] cluster
- C263 (= C85) binding [4Fe-4S] cluster
Sites not aligning to the query:
- 103 binding [2Fe-2S] cluster
- 108 binding [2Fe-2S] cluster
- 111 binding [2Fe-2S] cluster
- 123 binding [2Fe-2S] cluster
1yq3B Avian respiratory complex ii with oxaloacetate and ubiquinone (see paper)
28% identity, 21% coverage: 22:105/407 of query aligns to 150:241/242 of 1yq3B
- binding fe3-s4 cluster: C163 (= C35), Y173 (≠ L45), P176 (= P48), C210 (= C75), T212 (= T77), I213 (≠ C78), M214 (≠ R79), N215 (≠ S80), C216 (= C81)
- binding iron/sulfur cluster: C153 (= C25), I154 (≠ V26), L155 (≠ H27), C156 (= C28), A157 (≠ G29), C159 (= C31), A177 (≠ R49), C220 (= C85), P221 (= P86)
- binding Coenzyme Q10, (2Z,6E,10Z,14E,18E,22E,26Z)-isomer: P164 (= P36), W168 (≠ L40), I213 (≠ C78)
Sites not aligning to the query:
6myqB Avian mitochondrial complex ii with ferulenol bound (see paper)
28% identity, 21% coverage: 22:105/407 of query aligns to 147:238/239 of 6myqB
- binding 4-oxidanyl-3-[(2~{E},6~{E})-3,7,11-trimethyldodeca-2,6,10-trienyl]chromen-2-one: W165 (≠ L40), I210 (≠ C78)
- binding fe3-s4 cluster: C160 (= C35), Y170 (≠ L45), P173 (= P48), C207 (= C75), T209 (= T77), I210 (≠ C78), M211 (≠ R79), N212 (≠ S80), C213 (= C81)
- binding iron/sulfur cluster: C150 (= C25), I151 (≠ V26), L152 (≠ H27), C153 (= C28), C156 (= C31), A174 (≠ R49), C217 (= C85), P218 (= P86)
Sites not aligning to the query:
6mysB Avian mitochondrial complex ii with atpenin a5 bound, sidechain outside (see paper)
28% identity, 21% coverage: 22:105/407 of query aligns to 148:239/240 of 6mysB
- binding 3-[(2s,4s,5r)-5,6-dichloro-2,4-dimethyl-1-oxohexyl]-4-hydroxy-5,6-dimethoxy-2(1h)-pyridinone: P162 (= P36), W166 (≠ L40), H209 (≠ L76), I211 (≠ C78)
- binding fe3-s4 cluster: C161 (= C35), Y171 (≠ L45), P174 (= P48), C208 (= C75), T210 (= T77), I211 (≠ C78), M212 (≠ R79), N213 (≠ S80), C214 (= C81)
- binding iron/sulfur cluster: C151 (= C25), I152 (≠ V26), L153 (≠ H27), C154 (= C28), A155 (≠ G29), C157 (= C31), A175 (≠ R49), C218 (= C85)
Sites not aligning to the query:
6myrB Avian mitochondrial complex ii with thiapronil bound (see paper)
28% identity, 21% coverage: 22:105/407 of query aligns to 148:239/240 of 6myrB
- binding fe3-s4 cluster: C161 (= C35), Y171 (≠ L45), P174 (= P48), C208 (= C75), H209 (≠ L76), T210 (= T77), I211 (≠ C78), M212 (≠ R79), N213 (≠ S80), C214 (= C81)
- binding thiapronil: P162 (= P36), W166 (≠ L40), H209 (≠ L76), I211 (≠ C78)
- binding iron/sulfur cluster: C151 (= C25), I152 (≠ V26), L153 (≠ H27), C154 (= C28), A155 (≠ G29), C157 (= C31), A175 (≠ R49), C218 (= C85)
Sites not aligning to the query:
6mypB Avian mitochondrial complex ii with ttfa (thenoyltrifluoroacetone) bound (see paper)
28% identity, 21% coverage: 22:105/407 of query aligns to 148:239/240 of 6mypB
- binding fe3-s4 cluster: C161 (= C35), C208 (= C75), H209 (≠ L76), T210 (= T77), M212 (≠ R79), N213 (≠ S80), C214 (= C81)
- binding iron/sulfur cluster: C151 (= C25), I152 (≠ V26), L153 (≠ H27), C154 (= C28), A155 (≠ G29), C157 (= C31), A175 (≠ R49), C218 (= C85)
- binding 4,4,4-trifluoro-1-thien-2-ylbutane-1,3-dione: P162 (= P36), W166 (≠ L40), H209 (≠ L76)
Sites not aligning to the query:
6myoB Avian mitochondrial complex ii with flutolanyl bound (see paper)
28% identity, 21% coverage: 22:105/407 of query aligns to 148:239/240 of 6myoB
- binding fe3-s4 cluster: C161 (= C35), Y171 (≠ L45), P174 (= P48), C208 (= C75), T210 (= T77), I211 (≠ C78), M212 (≠ R79), N213 (≠ S80), C214 (= C81)
- binding N-[3-(1-methylethoxy)phenyl]-2-(trifluoromethyl)benzamide: W166 (≠ L40), H209 (≠ L76), I211 (≠ C78)
- binding iron/sulfur cluster: C151 (= C25), I152 (≠ V26), L153 (≠ H27), C154 (= C28), A155 (≠ G29), C157 (= C31), A175 (≠ R49), C218 (= C85)
Sites not aligning to the query:
2fbwB Avian respiratory complex ii with carboxin bound (see paper)
28% identity, 21% coverage: 22:105/407 of query aligns to 148:239/240 of 2fbwB
- binding 2-methyl-n-phenyl-5,6-dihydro-1,4-oxathiine-3-carboxamide: P162 (= P36), W166 (≠ L40), H209 (≠ L76)
- binding fe3-s4 cluster: C161 (= C35), Y171 (≠ L45), P174 (= P48), C208 (= C75), T210 (= T77), I211 (≠ C78), M212 (≠ R79), N213 (≠ S80), C214 (= C81)
- binding iron/sulfur cluster: C151 (= C25), I152 (≠ V26), L153 (≠ H27), C154 (= C28), C157 (= C31), A175 (≠ R49), C218 (= C85), P219 (= P86)
Sites not aligning to the query:
3sfeB Crystal structure of porcine mitochondrial respiratory complex ii bound with oxaloacetate and thiabendazole (see paper)
28% identity, 21% coverage: 22:105/407 of query aligns to 148:239/240 of 3sfeB
- binding fe3-s4 cluster: C161 (= C35), Y171 (≠ L45), P174 (= P48), C208 (= C75), T210 (= T77), I211 (≠ C78), M212 (≠ R79), N213 (≠ S80), C214 (= C81)
- binding iron/sulfur cluster: C151 (= C25), I152 (≠ V26), L153 (≠ H27), C154 (= C28), A155 (≠ G29), C157 (= C31), A175 (≠ R49), C218 (= C85), P219 (= P86), K220 (≠ S87), L222 (≠ V89)
- binding 2-(1,3-thiazol-4-yl)-1h-benzimidazole: H209 (≠ L76), I211 (≠ C78)
Sites not aligning to the query:
8gs8B Cryo-em structure of the human respiratory complex ii (see paper)
29% identity, 20% coverage: 22:102/407 of query aligns to 149:237/239 of 8gs8B
- binding fe3-s4 cluster: C162 (= C35), Y172 (≠ L45), P175 (= P48), C209 (= C75), H210 (≠ L76), T211 (= T77), I212 (≠ C78), M213 (≠ R79), N214 (≠ S80), C215 (= C81)
- binding iron/sulfur cluster: C152 (= C25), C155 (= C28), C158 (= C31), A176 (≠ R49), C219 (= C85)
- binding ubiquinone-1: P163 (= P36), W167 (≠ L40), I212 (≠ C78)
Sites not aligning to the query:
Query Sequence
>WP_047215942.1 NCBI__GCF_001931675.1:WP_047215942.1
MQTHLADFIRGTPAGDEADAILRKCVHCGFCTATCPTYQLLGDELDGPRGRIYLIKQMLE
GSDVSTRTVGHLDRCLTCRSCETTCPSGVEYGHLVDIGRQVAEQRASRPLVQRAQRKFLS
TFLPNPHLFGPALRLGQFLRPMLPRRLRRKIPLSGSSGQWPRQTHQRKMLMLAGCVQPAM
LPNINSATARVFDAVDIQLIMAPEAGCCGAIRHHLSDTAGALDDMRRNIDAWWPHLEQGV
ESIVINASGCGAMVKEYGHLLRHDSRYAARAERVAAAARDPSEILPAHAATLKQRTHRPG
NQVLAYHPPCTLQHAQQLRGEVERLLLELGVNLKPVQDSHLCCGSAGTYSLLQPELATRL
RDNKLAQCEAQRPATILSANVGCIAHLQSGTRTPVRHWIELVDSLLV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory