SitesBLAST
Comparing WP_047215943.1 NCBI__GCF_001931675.1:WP_047215943.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7qh2C Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
29% identity, 49% coverage: 3:177/357 of query aligns to 52:226/467 of 7qh2C
- binding flavin-adenine dinucleotide: V73 (≠ L24), G75 (= G26), S76 (≠ G27), G77 (= G28), T78 (= T29), G79 (≠ K30), L80 (≠ Q31), A83 (vs. gap), C84 (vs. gap), P137 (≠ F89), G138 (= G90), E139 (≠ P91), A142 (= A93), T143 (= T94), G146 (= G97), N147 (≠ C98), S149 (≠ A100), T150 (≠ A101), A152 (≠ L103), G153 (≠ S104), E203 (≠ L154), G204 (= G155), I209 (= I160)
Sites not aligning to the query:
3pm9A Crystal structure of a putative dehydrogenase (rpa1076) from rhodopseudomonas palustris cga009 at 2.57 a resolution
29% identity, 38% coverage: 54:190/357 of query aligns to 101:236/465 of 3pm9A
- active site: A149 (≠ L103), L159 (≠ A113)
- binding flavin-adenine dinucleotide: L133 (≠ P86), G134 (≠ P87), A135 (≠ Y88), C139 (≠ A93), T140 (= T94), G142 (= G96), G143 (= G97), S146 (≠ A100), T147 (≠ A101), A149 (≠ L103), G150 (≠ S104), E200 (≠ L154), G201 (= G155), I205 (≠ L159), I206 (= I160)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 69, 70, 71, 72, 73, 74, 75, 76, 79, 80, 91, 423
6lpxA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with 2-oxoglutarate (2-og) (see paper)
29% identity, 37% coverage: 41:173/357 of query aligns to 94:225/466 of 6lpxA
- binding flavin-adenine dinucleotide: L139 (≠ P86), G140 (≠ P87), A141 (≠ Y88), C145 (≠ A93), G149 (= G97), N150 (≠ C98), A152 (= A100), T153 (≠ A101), G157 (= G105), G207 (= G155), I212 (= I160)
Sites not aligning to the query:
- binding 2-oxoglutaric acid: 333, 337, 348, 379, 381, 388, 423
- binding flavin-adenine dinucleotide: 39, 75, 76, 77, 78, 79, 80, 81, 82, 85, 86, 422, 459
- binding zinc ion: 381, 388, 422
6lpuA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with l-2-hydroxyglutarate (l-2-hg) (see paper)
29% identity, 37% coverage: 41:173/357 of query aligns to 94:225/466 of 6lpuA
- binding flavin-adenine dinucleotide: L139 (≠ P86), G140 (≠ P87), A141 (≠ Y88), C145 (≠ A93), H146 (≠ T94), G148 (= G96), G149 (= G97), N150 (≠ C98), A152 (= A100), T153 (≠ A101), A155 (≠ L103), E206 (≠ L154), G207 (= G155), I211 (≠ L159), I212 (= I160)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 39, 75, 77, 78, 79, 80, 81, 85, 86, 422, 459
- binding (2s)-2-hydroxypentanedioic acid: 333, 337, 348, 379, 381, 388, 423
- binding zinc ion: 381, 388, 422
6lpqA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-malate (d-mal) (see paper)
29% identity, 37% coverage: 41:173/357 of query aligns to 94:225/466 of 6lpqA
- binding flavin-adenine dinucleotide: L139 (≠ P86), G140 (≠ P87), A141 (≠ Y88), C145 (≠ A93), H146 (≠ T94), G149 (= G97), N150 (≠ C98), A152 (= A100), T153 (≠ A101), A155 (≠ L103), G157 (= G105), E206 (≠ L154), G207 (= G155), I211 (≠ L159), I212 (= I160)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 39, 75, 77, 78, 79, 80, 81, 85, 86, 422, 459
- binding d-malate: 82, 333, 337, 348, 379, 381, 388, 422, 423
- binding zinc ion: 381, 388, 422
6lppA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-2-hydroxyglutarate (d-2-hg) (see paper)
29% identity, 37% coverage: 41:173/357 of query aligns to 94:225/466 of 6lppA
- binding flavin-adenine dinucleotide: L139 (≠ P86), G140 (≠ P87), A141 (≠ Y88), C145 (≠ A93), G149 (= G97), N150 (≠ C98), A152 (= A100), T153 (≠ A101), A155 (≠ L103), G157 (= G105), G207 (= G155), I212 (= I160)
Sites not aligning to the query:
- binding (2R)-2-hydroxypentanedioic acid: 333, 337, 348, 379, 381, 388, 390, 423
- binding flavin-adenine dinucleotide: 39, 75, 77, 78, 79, 80, 81, 82, 85, 86, 422, 423
- binding zinc ion: 381, 388, 422
Q8N465 D-2-hydroxyglutarate dehydrogenase, mitochondrial; EC 1.1.99.39 from Homo sapiens (Human) (see 7 papers)
29% identity, 37% coverage: 41:173/357 of query aligns to 147:278/521 of Q8N465
- I147 (≠ V41) to S: in D2HGA1; uncertain significance; severe phenotype; almost complete loss of catalytic activity; dbSNP:rs121434361
- M153 (≠ Y47) to T: in D2HGA1; uncertain significance; significant loss of catalytic activity; to V: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs1432270139
- C172 (≠ T66) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs773735172
- P189 (= P83) to L: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs587783517
- A205 (= A100) to V: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs750889931
- A231 (≠ G126) to V: in D2HGA1; uncertain significance; significant loss of catalytic activity
- G233 (= G128) to S: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs374535734
Sites not aligning to the query:
- 15 R → G: in dbSNP:rs4675887
- 109 S → W: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs142050154
- 127 N → K: in D2HGA1; uncertain significance; complete loss of catalytic activity; dbSNP:rs762857195
- 131 G → V: in D2HGA1; uncertain significance; complete loss of catalytic activity
- 169:521 natural variant: Missing (in D2HGA1; uncertain significance)
- 375 D → Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs267606759
- 386 binding (R)-2-hydroxyglutarate; binding (R)-lactate; binding (R)-malate; R→A: Loss of catalytic activity.
- 390 binding (R)-2-hydroxyglutarate; binding (R)-malate; T→A: Significantly reduced catalytic activity.
- 399 V → M: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746519212
- 400:521 natural variant: Missing (in D2HGA1; uncertain significance; complete loss of catalytic activity)
- 401 binding (R)-2-hydroxyglutarate; binding (R)-malate; K→A: Loss of catalytic activity.
- 419 R → H: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs199908032
- 426 A → T: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs146578303
- 434 binding Zn(2+); H→A: Loss of catalytic activity.
- 436 G → V: slight reduction in catalytic activity
- 439 N → D: in D2HGA1; uncertain significance; mild phenotype; moderate reduction in catalytic activity; dbSNP:rs121434362
- 441 binding Zn(2+); H→A: Loss of catalytic activity.
- 443 binding (R)-2-hydroxyglutarate; N→A: Significantly reduced catalytic activity.
- 444 V → A: in D2HGA1; uncertain significance; severe phenotype; significant reduction in catalytic activity; dbSNP:rs121434360
- 446 A → V: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746956176
- 475 binding Zn(2+); E→A: Loss of catalytic activity.
- 476 binding (R)-2-hydroxyglutarate; binding (R)-lactate; binding (R)-malate; H→A: Loss of catalytic activity.
- 477 G → R: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs1453924640
6lpnB Crystal structure of human d-2-hydroxyglutarate dehydrogenase in apo form (see paper)
29% identity, 37% coverage: 41:173/357 of query aligns to 95:226/467 of 6lpnB
- binding flavin-adenine dinucleotide: L140 (≠ P86), A142 (≠ Y88), C146 (≠ A93), H147 (≠ T94), G150 (= G97), N151 (≠ C98), A153 (= A100), T154 (≠ A101), G208 (= G155), I212 (≠ L159), I213 (= I160)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 40, 76, 78, 79, 80, 81, 82, 83, 86, 87, 423, 460
P39976 D-2-hydroxyglutarate--pyruvate transhydrogenase DLD3; D-2HG--pyruvate transhydrogenase DLD3; (R)-2-hydroxyglutarate--pyruvate transhydrogenase; D-lactate dehydrogenase [cytochrome] 3; D-lactate ferricytochrome C oxidoreductase; D-LCR; EC 1.1.99.40; EC 1.1.2.4 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
25% identity, 42% coverage: 41:190/357 of query aligns to 115:263/496 of P39976
Sites not aligning to the query:
- 17 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
P9WIT1 Uncharacterized FAD-linked oxidoreductase Rv2280; EC 1.-.-.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
26% identity, 46% coverage: 6:170/357 of query aligns to 50:214/459 of P9WIT1
Sites not aligning to the query:
- 354 modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
5adzC Ether lipid-generating enzyme agps in complex with inhibitor 1a (see paper)
27% identity, 41% coverage: 26:171/357 of query aligns to 156:305/557 of 5adzC
- binding flavin-adenine dinucleotide: G156 (= G26), G157 (= G27), G158 (= G28), T159 (= T29), S160 (≠ K30), P222 (= P86), D223 (≠ P87), S224 (≠ Y88), S228 (≠ A93), T229 (= T94), G232 (= G97), W233 (≠ C98), S235 (≠ A100), T236 (≠ A101), A238 (≠ L103), S239 (= S104), E288 (≠ L154), G289 (= G155), I294 (= I160)
- binding (3S)-3-(2-fluorophenyl)-N-((2-oxo-2,3-dihydro-1H-benzo[d]imidazol-5-yl)methyl)butanamide): D223 (≠ P87)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 16, 154, 155, 515
- binding (3S)-3-(2-fluorophenyl)-N-((2-oxo-2,3-dihydro-1H-benzo[d]imidazol-5-yl)methyl)butanamide): 410, 414, 424, 425, 426, 477, 515, 516
6gouA Development of alkyl glycerone phosphate synthase inhibitors: complex with inhibitor 2i (see paper)
27% identity, 41% coverage: 26:171/357 of query aligns to 156:305/554 of 6gouA
- binding (3~{S})-3-[2,6-bis(fluoranyl)phenyl]-~{N}-[(2-oxidanylidene-1,3-dihydrobenzimidazol-5-yl)methyl]butanamide: D223 (≠ P87)
- binding flavin-adenine dinucleotide: G156 (= G26), G157 (= G27), G158 (= G28), T159 (= T29), S160 (≠ K30), V161 (≠ Q31), G164 (= G34), P222 (= P86), D223 (≠ P87), S224 (≠ Y88), S228 (≠ A93), T229 (= T94), G232 (= G97), W233 (≠ C98), S235 (≠ A100), T236 (≠ A101), A238 (≠ L103), S239 (= S104), E288 (≠ L154), V293 (≠ L159), I294 (= I160)
Sites not aligning to the query:
- binding (3~{S})-3-[2,6-bis(fluoranyl)phenyl]-~{N}-[(2-oxidanylidene-1,3-dihydrobenzimidazol-5-yl)methyl]butanamide: 411, 421, 422, 423, 474, 476, 478
- binding flavin-adenine dinucleotide: 16, 154, 155, 512
5ae3A Ether lipid-generating enzyme agps in complex with antimycin a (see paper)
27% identity, 41% coverage: 26:171/357 of query aligns to 142:291/539 of 5ae3A
- binding flavin-adenine dinucleotide: G142 (= G26), G143 (= G27), G144 (= G28), T145 (= T29), S146 (≠ K30), V147 (≠ Q31), L151 (≠ Q35), P208 (= P86), D209 (≠ P87), S210 (≠ Y88), S214 (≠ A93), T215 (= T94), G218 (= G97), W219 (≠ C98), S221 (≠ A100), T222 (≠ A101), A224 (≠ L103), S225 (= S104), E274 (≠ L154), V279 (≠ L159), I280 (= I160)
Sites not aligning to the query:
- binding [(2R,3S,6S,7R,8R)-3-[(3-formamido-2-oxidanyl-phenyl)carbonylamino]-8-hexyl-2,6-dimethyl-4,9-bis(oxidanylidene)-1,5-dioxonan-7-yl] 3-methylbutanoate: 45, 49, 53, 325, 327, 331, 334, 349, 386, 393, 396, 400, 447, 461
- binding flavin-adenine dinucleotide: 140, 141, 497
P97275 Alkyldihydroxyacetonephosphate synthase, peroxisomal; Alkyl-DHAP synthase; Alkylglycerone-phosphate synthase; EC 2.5.1.26 from Cavia porcellus (Guinea pig) (see 4 papers)
27% identity, 41% coverage: 26:171/357 of query aligns to 236:385/658 of P97275
- H300 (≠ F84) mutation to A: Loss of activity.
- 303:309 (vs. 87:94, 13% identical) binding FAD
- T309 (= T94) mutation to I: Impaired FAD binding and protein stability. Loss of activity.
- TRAS 316:319 (≠ AGLS 101:104) binding FAD
- S367 (= S153) mutation to A: Strongly reduced activity.
- 368:374 (vs. 154:160, 57% identical) binding FAD
Sites not aligning to the query:
- 1:58 modified: transit peptide, Peroxisome
- 234:240 binding FAD
- 419 Important for enzyme activity; R→H: Loss of activity.; R→K: Strongly reduced activity.
- 469 L→P: Impaired FAD binding and protein stability. Loss of activity.
- 515 binding substrate; R→L: Impaired FAD binding and protein stability. Loss of activity.
- 576 C→A: No effect on activity.
- 578 active site, Proton donor/acceptor; Y→F: Loss of activity.
- 615 H→A: Loss of activity.
- 615:617 Important for enzyme activity
- 616 H→A: Loss of activity.
- 617 H→A: Loss of activity.
- 654:658 Important for enzyme activity
4bc9A Mammalian alkyldihydroxyacetonephosphate synthase: wild-type, adduct with cyanoethyl (see paper)
27% identity, 41% coverage: 26:171/357 of query aligns to 147:296/555 of 4bc9A
- binding propanenitrile: D214 (≠ P87)
- binding flavin-adenine dinucleotide: G147 (= G26), G148 (= G27), G149 (= G28), T150 (= T29), S151 (≠ K30), V152 (≠ Q31), G155 (= G34), L156 (≠ Q35), P213 (= P86), D214 (≠ P87), S215 (≠ Y88), S219 (≠ A93), T220 (= T94), G223 (= G97), W224 (≠ C98), S226 (≠ A100), T227 (≠ A101), A229 (≠ L103), S230 (= S104), E279 (≠ L154), V284 (≠ L159), I285 (= I160)
Sites not aligning to the query:
4bc9B Mammalian alkyldihydroxyacetonephosphate synthase: wild-type, adduct with cyanoethyl (see paper)
27% identity, 41% coverage: 26:171/357 of query aligns to 142:291/542 of 4bc9B
- binding propanenitrile: D209 (≠ P87)
- binding flavin-adenine dinucleotide: G142 (= G26), G143 (= G27), G144 (= G28), T145 (= T29), S146 (≠ K30), V147 (≠ Q31), G150 (= G34), L151 (≠ Q35), P208 (= P86), D209 (≠ P87), S210 (≠ Y88), S214 (≠ A93), T215 (= T94), G218 (= G97), W219 (≠ C98), S221 (≠ A100), T222 (≠ A101), A224 (≠ L103), S225 (= S104), E274 (≠ L154), G275 (= G155), I280 (= I160)
Sites not aligning to the query:
5ae1B Ether lipid-generating enzyme agps in complex with inhibitor zinc69435460 (see paper)
27% identity, 41% coverage: 26:171/357 of query aligns to 142:291/539 of 5ae1B
- binding flavin-adenine dinucleotide: G142 (= G26), G143 (= G27), G144 (= G28), T145 (= T29), S146 (≠ K30), G150 (= G34), L151 (≠ Q35), P208 (= P86), D209 (≠ P87), S210 (≠ Y88), S214 (≠ A93), T215 (= T94), G218 (= G97), W219 (≠ C98), S221 (≠ A100), T222 (≠ A101), A224 (≠ L103), S225 (= S104), E274 (≠ L154), V279 (≠ L159), I280 (= I160)
Sites not aligning to the query:
- binding (3-(2-fluorophenyl)-n-(1-(2-oxo-2,3-dihydro-1h-benzo[d]imidazol-5-yl)ethyl)butanamide): 392, 396, 406, 407, 408, 459, 497
- binding flavin-adenine dinucleotide: 16, 140, 141, 497, 535
5ae2B Ether lipid-generating enzyme agps in complex with inhibitor 1e (see paper)
27% identity, 41% coverage: 26:171/357 of query aligns to 142:291/542 of 5ae2B
- binding flavin-adenine dinucleotide: G142 (= G26), G143 (= G27), G144 (= G28), T145 (= T29), S146 (≠ K30), G150 (= G34), L151 (≠ Q35), P208 (= P86), D209 (≠ P87), S210 (≠ Y88), S214 (≠ A93), T215 (= T94), G218 (= G97), W219 (≠ C98), S221 (≠ A100), T222 (≠ A101), A224 (≠ L103), S225 (= S104), E274 (≠ L154), G275 (= G155), V279 (≠ L159), I280 (= I160)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 16, 140, 500
- binding 3-(2-fluorophenyl)-2-methyl-N-((2-oxo-2,3-dihydro-1H-benzo[d]imidazol-5-yl)methyl)acrylamide: 399, 409, 410, 411, 462, 464, 466, 500, 501
5ae2A Ether lipid-generating enzyme agps in complex with inhibitor 1e (see paper)
27% identity, 41% coverage: 26:171/357 of query aligns to 147:296/561 of 5ae2A
- binding flavin-adenine dinucleotide: G147 (= G26), G148 (= G27), G149 (= G28), T150 (= T29), S151 (≠ K30), G155 (= G34), L156 (≠ Q35), P213 (= P86), D214 (≠ P87), S215 (≠ Y88), S219 (≠ A93), T220 (= T94), G223 (= G97), W224 (≠ C98), S226 (≠ A100), T227 (≠ A101), A229 (≠ L103), S230 (= S104), E279 (≠ L154), V284 (≠ L159), I285 (= I160)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 16, 145, 146, 519
- binding 3-(2-fluorophenyl)-2-methyl-N-((2-oxo-2,3-dihydro-1H-benzo[d]imidazol-5-yl)methyl)acrylamide: 415, 418, 428, 429, 430, 481, 483, 519
5ae1A Ether lipid-generating enzyme agps in complex with inhibitor zinc69435460 (see paper)
27% identity, 41% coverage: 26:171/357 of query aligns to 141:290/560 of 5ae1A
- binding flavin-adenine dinucleotide: G141 (= G26), G142 (= G27), G143 (= G28), T144 (= T29), S145 (≠ K30), V146 (≠ Q31), G149 (= G34), L150 (≠ Q35), P207 (= P86), D208 (≠ P87), S209 (≠ Y88), S213 (≠ A93), T214 (= T94), G216 (= G96), G217 (= G97), W218 (≠ C98), S220 (≠ A100), T221 (≠ A101), A223 (≠ L103), S224 (= S104), E273 (≠ L154), G274 (= G155), V278 (≠ L159), I279 (= I160)
Sites not aligning to the query:
Query Sequence
>WP_047215943.1 NCBI__GCF_001931675.1:WP_047215943.1
MNTVLEQFRAAIETATATHQPLQLRGGGTKQWYGQQLVGQVLDTRPYRGVIAYDPAELVI
TARCGTPLAEIEAVLAEKNQLLPFEPPYFGPHATFGGCVAAGLSGPRRQAAGAVRDFVLG
AALMDGKGQVLHFGGQVMKNVAGYDVARLLAGSLGILGLILDVSIKVMPQPFAELTLRFE
MNAVDAVRKLNEWGGQPLPISASAWYDDMLAVRLSGASAAIKAARVKLGGELVDAIHAAK
FWQGVREHTDPFFADAGPERALWRLSLPPITEPHRLPGKQLIEWGGAQRWWITDADAQSV
RSAARQAGGHATLFRYGEASAGVFTPLAVPLMRIHRNLKAAFDPAGIFNPGRMYPEL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory