Comparing WP_048044721.1 NCBI__GCF_000007065.1:WP_048044721.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
1ox5A Towards understanding the mechanism of the complex cyclization reaction catalyzed by imidazole glycerophosphate synthase (see paper)
36% identity, 100% coverage: 1:201/202 of query aligns to 4:214/532 of 1ox5A
Sites not aligning to the query:
1ox4B Towards understanding the mechanism of the complex cyclization reaction catalyzed by imidazole glycerophosphate synthase (see paper)
36% identity, 100% coverage: 1:201/202 of query aligns to 4:214/538 of 1ox4B
Sites not aligning to the query:
P33734 Imidazole glycerol phosphate synthase hisHF; IGP synthase; IGPS; ImGP synthase; EC 4.3.2.10; EC 3.5.1.2 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
36% identity, 100% coverage: 1:201/202 of query aligns to 1:211/552 of P33734
Sites not aligning to the query:
7ac8B Molecular basis for the unique allosteric activation mechanism of the heterodimeric imidazole glycerol phosphate synthase complex. (see paper)
34% identity, 98% coverage: 3:200/202 of query aligns to 4:197/202 of 7ac8B
2ywcA Crystal structure of gmp synthetase from thermus thermophilus in complex with xmp
28% identity, 65% coverage: 71:202/202 of query aligns to 70:184/475 of 2ywcA
Sites not aligning to the query:
P37528 Pyridoxal 5'-phosphate synthase subunit PdxT; Pdx2; Pyridoxal 5'-phosphate synthase glutaminase subunit; EC 4.3.3.6; EC 3.5.1.2 from Bacillus subtilis (strain 168) (see 2 papers)
27% identity, 94% coverage: 12:201/202 of query aligns to 11:186/196 of P37528
Sites not aligning to the query:
7yc6A Crystal structure of d110p mutant of gatase subunit of methanocaldococcus jannaschii gmp synthetase
26% identity, 99% coverage: 4:202/202 of query aligns to 2:178/183 of 7yc6A
2nv2J Structure of the plp synthase complex pdx1/2 (yaad/e) from bacillus subtilis (see paper)
26% identity, 94% coverage: 12:201/202 of query aligns to 11:186/196 of 2nv2J
P49915 GMP synthase [glutamine-hydrolyzing]; GMP synthetase; Glutamine amidotransferase; EC 6.3.5.2 from Homo sapiens (Human) (see paper)
29% identity, 63% coverage: 72:199/202 of query aligns to 97:207/693 of P49915
Sites not aligning to the query:
2vxoB Human gmp synthetase in complex with xmp (see paper)
30% identity, 63% coverage: 72:199/202 of query aligns to 75:182/658 of 2vxoB
Sites not aligning to the query:
>WP_048044721.1 NCBI__GCF_000007065.1:WP_048044721.1
MKRIVIIDYGLGNLRSVQKGLEHAGASPAISGNPEEILAADGIILPGVGAFIDAMKCLVP
LKKTIAEFAESGKPMLGICLGQQVLMSSSEEGRLTDGLDLIQGRVLRFPKSELKVPQMGW
NNIRVKQDHPLFKGIPDGSFVYFVHSYYVDTAAENTLASCEYGLEYAASVVNSKGNVMGT
QFHPEKSGATGLKILRNFVEMC
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory