Comparing WP_048060911.1 NCBI__GCF_000008645.1:WP_048060911.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5dn1A Crystal structure of phosphoribosyl isomerase a from streptomyces coelicolor (see paper)
36% identity, 96% coverage: 7:241/246 of query aligns to 3:237/240 of 5dn1A
P16250 Phosphoribosyl isomerase A; 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; N-(5'-phosphoribosyl)anthranilate isomerase; PRAI; Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase; EC 5.3.1.16; EC 5.3.1.24 from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) (see paper)
36% identity, 96% coverage: 7:241/246 of query aligns to 3:237/240 of P16250
4tx9A Crystal structure of hisap from streptomyces sviceus with degraded profar (see paper)
37% identity, 96% coverage: 7:241/246 of query aligns to 8:242/246 of 4tx9A
3zs4A Crystal structure of mycobacterium tuberculosis phosphoribosyl isomerase with bound prfar
35% identity, 95% coverage: 8:240/246 of query aligns to 3:239/244 of 3zs4A
2y88A Crystal structure of mycobacterium tuberculosis phosphoribosyl isomerase (variant d11n) with bound prfar (see paper)
35% identity, 95% coverage: 8:240/246 of query aligns to 3:239/244 of 2y88A
5abtA S.Enterica hisa mutant d7n, g102a, v106m, d176a
30% identity, 97% coverage: 9:246/246 of query aligns to 1:246/246 of 5abtA
2y85A Crystal structure of mycobacterium tuberculosis phosphoribosyl isomerase with bound rcdrp (see paper)
33% identity, 95% coverage: 8:240/246 of query aligns to 3:230/234 of 2y85A
Q9X0C7 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase; EC 5.3.1.16 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
29% identity, 96% coverage: 8:242/246 of query aligns to 1:239/241 of Q9X0C7
1h5yB Hisf protein from pyrobaculum aerophilum (see paper)
34% identity, 83% coverage: 8:212/246 of query aligns to 5:213/253 of 1h5yB
Sites not aligning to the query:
5ab3A S.Enterica hisa mutant d7n, d10g, dup13-15, q24l, g102a (see paper)
28% identity, 95% coverage: 9:241/246 of query aligns to 1:237/241 of 5ab3A
P60664 Imidazole glycerol phosphate synthase subunit HisF; IGP synthase cyclase subunit; IGP synthase subunit HisF; ImGP synthase subunit HisF; IGPS subunit HisF; EC 4.3.2.10 from Escherichia coli (strain K12) (see paper)
25% identity, 95% coverage: 10:242/246 of query aligns to 6:247/258 of P60664
Sites not aligning to the query:
3zr4E Structural evidence for ammonia tunneling across the (beta-alpha)8 barrel of the imidazole glycerol phosphate synthase bienzyme complex (see paper)
25% identity, 83% coverage: 10:212/246 of query aligns to 6:201/244 of 3zr4E
Sites not aligning to the query:
7qc8A Imidazole glycerol phosphate synthase subunit HisF (see paper)
27% identity, 83% coverage: 10:212/246 of query aligns to 6:210/250 of 7qc8A
7ac8A Molecular basis for the unique allosteric activation mechanism of the heterodimeric imidazole glycerol phosphate synthase complex. (see paper)
25% identity, 83% coverage: 10:212/246 of query aligns to 6:210/252 of 7ac8A
Sites not aligning to the query:
Q9X0C6 Imidazole glycerol phosphate synthase subunit HisF; IGP synthase cyclase subunit; IGP synthase subunit HisF; ImGP synthase subunit HisF; IGPS subunit HisF; EC 4.3.2.10 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
25% identity, 83% coverage: 10:212/246 of query aligns to 6:210/253 of Q9X0C6
1gpwC Structural evidence for ammonia tunneling across the (beta/alpha)8 barrel of the imidazole glycerol phosphate synthase bienzyme complex. (see paper)
25% identity, 83% coverage: 10:212/246 of query aligns to 6:210/253 of 1gpwC
Sites not aligning to the query:
2wjzE Crystal structure of (hish) k181a y138a mutant of imidazoleglycerolphosphate synthase (hish hisf) which displays constitutive glutaminase activity (see paper)
25% identity, 83% coverage: 10:212/246 of query aligns to 6:196/237 of 2wjzE
4ewnD Structure of hisf-d130v+d176v with bound rcdrp (see paper)
25% identity, 83% coverage: 10:212/246 of query aligns to 5:203/243 of 4ewnD
Sites not aligning to the query:
5d2tA Directed evolutionary changes in kemp eliminase ke07 - crystal 3 wild type
22% identity, 95% coverage: 10:242/246 of query aligns to 4:238/251 of 5d2tA
3iivB Evolutionary optimization of computationally designed enzymes: kemp eliminases of the ke07 series (see paper)
22% identity, 95% coverage: 10:242/246 of query aligns to 6:239/262 of 3iivB
>WP_048060911.1 NCBI__GCF_000008645.1:WP_048060911.1
MSFWKDRMLIIPAVDIKDGKCVQLVQGKPGTEQVVLDDPAGVAGRWESLGAETIHVVDLD
GALGLEKNTGILKEITERVSVPLQIGGGIRSREYAGKLLDMGFERVILGTMAIENPAIVE
ELAGEYGSERIMVSLDSRDSRVVIRGWTEKVPFTAEEMARKFQERGAGSILFTNVDFEGL
LSGFDLKPVSELVEAVEIPVIYSGGVSSLNDLRMLQGTGVMGVVIGSAIYRGLIDLTEAL
KYQDLK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.