Comparing WP_048061191.1 NCBI__GCF_000008645.1:WP_048061191.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
7bgnA Crystal structure of mthisn2-amp complex, a bifunctional enzyme from the histidine biosynthetic pathway (see paper)
40% identity, 71% coverage: 14:105/129 of query aligns to 16:107/204 of 7bgnA
Sites not aligning to the query:
7bgmA Crystal structure of mthisn2, a bifunctional enzyme from the histidine biosynthetic pathway (see paper)
40% identity, 71% coverage: 14:105/129 of query aligns to 18:109/213 of 7bgmA
Sites not aligning to the query:
6j2lA Crystal structure of bi-functional enzyme (see paper)
41% identity, 68% coverage: 14:101/129 of query aligns to 17:104/200 of 6j2lA
Sites not aligning to the query:
6j2lB Crystal structure of bi-functional enzyme (see paper)
39% identity, 68% coverage: 14:101/129 of query aligns to 16:97/185 of 6j2lB
Sites not aligning to the query:
>WP_048061191.1 NCBI__GCF_000008645.1:WP_048061191.1
MLLNFRHNINGEDLIIAVAQDHETGEVLMVAYMNREALRRTLETGTAHYWSTSRGKLWLK
GESSGHVQRVKDVLVDCDGDAVVLKVEQEGGACHTGYRSCFYRSIDGDELKVREDAVKVF
DPEEIYGDG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory