SitesBLAST
Comparing WP_048065229.1 NCBI__GCF_000007345.1:WP_048065229.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8a6tB Cryo-em structure of the electron bifurcating fe-fe hydrogenase hydabc complex from thermoanaerobacter kivui in the reduced state (see paper)
34% identity, 66% coverage: 43:127/128 of query aligns to 548:630/630 of 8a6tB
- binding iron/sulfur cluster: Y575 (≠ R70), I577 (= I72), C582 (= C79), I583 (≠ V80), C585 (= C82), C588 (= C85), C592 (= C89), A596 (≠ V93), I597 (≠ Y94), I607 (≠ V104), C612 (= C109), C618 (= C115), C622 (= C119), K624 (≠ H121), A626 (= A123), I627 (≠ L124)
- binding zinc ion: H558 (≠ R53), C564 (≠ E59)
Sites not aligning to the query:
- binding fe2/s2 (inorganic) cluster: 31, 33, 36, 82, 85, 86
- binding flavin mononucleotide: 201, 227, 230, 355, 535, 536
- binding nadp nicotinamide-adenine-dinucleotide phosphate: 320, 337, 340, 341, 342, 433
- binding iron/sulfur cluster: 487, 488, 489, 491, 494, 534, 536, 537
- binding zinc ion: 471
1kqfB Formate dehydrogenase n from e. Coli (see paper)
35% identity, 56% coverage: 56:127/128 of query aligns to 109:186/289 of 1kqfB
- binding protoporphyrin ix containing fe: Y137 (≠ A84)
- binding iron/sulfur cluster: C111 (≠ L58), P112 (≠ E59), I117 (= I64), V125 (≠ I72), C132 (= C79), I133 (≠ V80), G134 (≠ E81), C135 (= C82), G136 (= G83), Y137 (≠ A84), C138 (= C85), C142 (= C89), I146 (≠ V93), P147 (≠ Y94), V156 (vs. gap), K158 (≠ T99), C159 (≠ W100), L161 (= L102), C162 (= C103), P172 (≠ G113), C174 (= C115), C178 (= C119), P179 (= P120), I183 (≠ L124)
Sites not aligning to the query:
- binding protoporphyrin ix containing fe: 252
- binding iron/sulfur cluster: 31, 38, 39, 40, 41, 42, 44, 48, 52, 77, 79, 99, 100, 101, 102, 105, 107
P0AAJ3 Formate dehydrogenase, nitrate-inducible, iron-sulfur subunit; Anaerobic formate dehydrogenase iron-sulfur subunit; Formate dehydrogenase-N subunit beta; FDH-N subunit beta from Escherichia coli (strain K12) (see paper)
35% identity, 56% coverage: 56:127/128 of query aligns to 110:187/294 of P0AAJ3
- C112 (≠ L58) binding
- C133 (= C79) binding
- C136 (= C82) binding
- C139 (= C85) binding
- C143 (= C89) binding
- C160 (≠ W100) binding
- C163 (= C103) binding
- C175 (= C115) binding
- C179 (= C119) binding
Sites not aligning to the query:
- 39 binding
- 42 binding
- 45 binding
- 49 binding
- 100 binding
- 103 binding
- 108 binding
7q4vF Electron bifurcating hydrogenase - hydabc from a. Woodii (see paper)
33% identity, 62% coverage: 46:124/128 of query aligns to 391:467/470 of 7q4vF
- binding iron/sulfur cluster: F415 (≠ R70), I417 (= I72), C422 (= C79), G424 (≠ E81), C425 (= C82), G426 (= G83), I427 (≠ A84), C428 (= C85), C432 (= C89), P433 (= P90), I437 (≠ Y94), Y445 (≠ L102), C452 (= C109), K454 (≠ Q111), C455 (= C112), G456 (= G113), A457 (≠ M114), C458 (= C115), C462 (= C119), P463 (= P120), I467 (≠ L124)
- binding zinc ion: H398 (≠ R53), C404 (≠ E59), C409 (≠ I64)
Sites not aligning to the query:
- binding flavin mononucleotide: 37, 39, 67, 158, 159, 160, 375
- binding nicotinamide-adenine-dinucleotide: 40, 43, 48, 177, 180, 297
- binding iron/sulfur cluster: 327, 328, 329, 330, 331, 334, 373, 374
- binding zinc ion: 311
7q4vB Electron bifurcating hydrogenase - hydabc from a. Woodii (see paper)
33% identity, 62% coverage: 46:124/128 of query aligns to 520:596/599 of 7q4vB
- binding iron/sulfur cluster: F544 (≠ R70), C551 (= C79), K552 (≠ V80), G553 (≠ E81), C554 (= C82), G555 (= G83), I556 (≠ A84), C557 (= C85), C561 (= C89), P562 (= P90), Y574 (≠ L102), C581 (= C109), K583 (≠ Q111), C584 (= C112), G585 (= G113), A586 (≠ M114), C587 (= C115), C591 (= C119), F593 (≠ H121), S595 (≠ A123)
- binding zinc ion: H527 (≠ R53), C533 (≠ E59)
Sites not aligning to the query:
- binding fe2/s2 (inorganic) cluster: 11, 16, 48, 49, 51, 52
- binding flavin mononucleotide: 166, 168, 196, 198, 284, 287, 288, 289, 324
- binding iron/sulfur cluster: 457, 458, 459, 460, 463, 503, 506
- binding zinc ion: 440
8a5eB Cryo-em structure of the electron bifurcating fe-fe hydrogenase hydabc complex from acetobacterium woodii in the reduced state (see paper)
33% identity, 62% coverage: 46:124/128 of query aligns to 368:444/447 of 8a5eB
- binding iron/sulfur cluster: F392 (≠ R70), C399 (= C79), G401 (≠ E81), C402 (= C82), G403 (= G83), C405 (= C85), C409 (= C89), P410 (= P90), I414 (≠ Y94), C429 (= C109), K431 (≠ Q111), C432 (= C112), G433 (= G113), C435 (= C115), C439 (= C119), P440 (= P120), I444 (≠ L124)
- binding zinc ion: H375 (≠ R53), C381 (≠ E59), C386 (≠ I64)
Sites not aligning to the query:
- binding flavin mononucleotide: 14, 16, 44, 135, 137, 171, 172, 352
- binding 1,4-dihydronicotinamide adenine dinucleotide: 16, 17, 20, 25, 28, 49, 154, 157, 250
- binding iron/sulfur cluster: 151, 305, 306, 307, 308, 311, 351, 354
- binding zinc ion: 288
7bkdA Formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (heterodislfide reductase core and mobile arm in conformational state 1, composite structure) (see paper)
39% identity, 40% coverage: 76:126/128 of query aligns to 593:646/664 of 7bkdA
- binding iron/sulfur cluster: C596 (= C79), A597 (≠ V80), C599 (= C82), G600 (= G83), C602 (= C85), C606 (= C89), L611 (≠ Y94), C629 (= C109), K630 (≠ I110), C632 (= C112), G633 (= G113), C635 (= C115), C639 (= C119), I644 (≠ L124)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 149, 150, 152, 153, 173, 174, 180, 181, 185, 188, 189, 339, 340, 341, 342, 368, 419, 422, 552, 557, 559
- binding iron/sulfur cluster: 10, 12, 45, 69, 70, 257, 259, 260, 261, 263, 267, 268, 284, 285, 297, 304, 305, 306, 307, 308, 310, 314, 319, 397, 398, 412, 413, 414, 416, 417, 444
7bkcK Formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (dimeric, composite structure) (see paper)
40% identity, 41% coverage: 75:126/128 of query aligns to 32:94/321 of 7bkcK
- binding iron/sulfur cluster: C36 (= C79), T37 (≠ V80), C39 (= C82), C42 (= C85), C46 (= C89), P47 (= P90), I51 (≠ Y94), C77 (= C109), S78 (≠ I110), Y79 (≠ Q111), C80 (= C112), G81 (= G113), C83 (= C115), C87 (= C119), L92 (= L124)
Sites not aligning to the query:
- binding iron/sulfur cluster: 119, 124, 125, 127, 130, 134, 135, 139, 178, 183, 184, 185, 186, 187, 189, 193, 194, 198, 208, 215, 216, 219, 221, 222, 226, 257, 258, 259, 260, 261, 263, 267, 268
1clfA Clostridium pasteurianum ferredoxin (see paper)
41% identity, 40% coverage: 73:123/128 of query aligns to 2:51/55 of 1clfA
- binding iron/sulfur cluster: I4 (≠ D75), C8 (= C79), V9 (= V80), C11 (= C82), G12 (= G83), A13 (= A84), C14 (= C85), C18 (= C89), P19 (= P90), V20 (≠ M91), F30 (≠ S101), C37 (= C109), I38 (= I110), C40 (= C112), N42 (≠ M114), C43 (= C115), C47 (= C119), A51 (= A123)
P00195 Ferredoxin from Clostridium pasteurianum (see 2 papers)
41% identity, 40% coverage: 73:123/128 of query aligns to 3:52/56 of P00195
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
7p8nB Tmhydabc- t. Maritima hydrogenase with bridge closed (see paper)
34% identity, 37% coverage: 79:125/128 of query aligns to 567:613/613 of 7p8nB
- binding iron/sulfur cluster: C567 (= C79), C570 (= C82), G571 (= G83), C573 (= C85), C577 (= C89), Y590 (≠ L102), I592 (≠ V104), C597 (= C109), K599 (≠ Q111), C600 (= C112), G601 (= G113), C603 (= C115), C607 (= C119)
Sites not aligning to the query:
- binding fe2/s2 (inorganic) cluster: 31, 33, 34, 36, 67, 68, 69, 70, 71
- binding flavin mononucleotide: 185, 186, 187, 213, 215, 216, 217, 301, 304, 305, 306, 340, 341, 521, 522
- binding iron/sulfur cluster: 320, 473, 474, 475, 476, 477, 480, 519, 520, 522, 523, 560
- binding zinc ion: 457, 544, 549, 554
7bkbK Formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (hexameric, composite structure) (see paper)
40% identity, 41% coverage: 75:126/128 of query aligns to 32:94/386 of 7bkbK
- binding iron/sulfur cluster: C36 (= C79), T37 (≠ V80), C39 (= C82), C42 (= C85), C46 (= C89), P47 (= P90), I51 (≠ Y94), C77 (= C109), S78 (≠ I110), Y79 (≠ Q111), C80 (= C112), G81 (= G113), C83 (= C115), C87 (= C119), L92 (= L124)
Sites not aligning to the query:
- binding iron/sulfur cluster: 119, 124, 125, 127, 130, 134, 139, 173, 174, 175, 176, 179, 183, 186, 211, 212, 214, 215, 217, 221, 222, 241, 248, 249, 251, 254, 258, 259, 263, 265, 273, 280, 281, 284, 286, 287, 291, 322, 323, 324, 325, 326, 328, 332, 333
P00219 Zinc-containing ferredoxin from Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) (see paper)
29% identity, 73% coverage: 34:126/128 of query aligns to 1:100/103 of P00219
- K29 (≠ A63) modified: N6-methyllysine
8a8oD Paps reductase from methanothermococcus thermolithotrophicus refined to 1.45 a (see paper)
38% identity, 40% coverage: 76:126/128 of query aligns to 6:57/102 of 8a8oD
- binding iron/sulfur cluster: C9 (= C79), I10 (≠ V80), G11 (≠ E81), C12 (= C82), G13 (= G83), C15 (= C85), C19 (= C89), P20 (= P90), S32 (= S101), C40 (= C109), W41 (≠ I110), D42 (≠ Q111), C43 (= C112), A44 (≠ G113), C46 (= C115), C50 (= C119), I55 (≠ L124)
Sites not aligning to the query:
5t61L Tungsten formylmethanofuran dehydrogenase subunit fwdF (see paper)
39% identity, 41% coverage: 75:126/128 of query aligns to 266:324/348 of 5t61L
- binding iron/sulfur cluster: C270 (= C79), A272 (≠ E81), C273 (= C82), E274 (≠ G83), C276 (= C85), C280 (= C89), P281 (= P90), V284 (= V93), C307 (= C109), I308 (= I110), Y309 (≠ Q111), C310 (= C112), G311 (= G113), C313 (= C115), C317 (= C119)
Sites not aligning to the query:
- binding iron/sulfur cluster: 30, 31, 32, 33, 34, 36, 40, 41, 70, 71, 72, 73, 74, 76, 80, 85, 114, 117, 118, 120, 124, 129, 146, 153, 156, 159, 163, 164, 168, 186, 193, 195, 196, 197, 199, 203, 204, 208, 212, 215, 238, 239, 240, 241, 242, 244, 248, 249
3egwB The crystal structure of the narghi mutant narh - c16a
32% identity, 67% coverage: 36:121/128 of query aligns to 146:229/509 of 3egwB
- binding fe3-s4 cluster: P181 (= P71), C196 (= C89), S198 (≠ M91), I201 (≠ V93), C217 (= C109), R218 (≠ I110), G219 (≠ Q111), W220 (≠ C112), R221 (≠ G113), C223 (= C115)
- binding protoporphyrin ix containing fe: W220 (≠ C112), R221 (≠ G113)
- binding iron/sulfur cluster: C184 (≠ E76), E185 (= E77), H186 (≠ E78), C187 (= C79), P190 (≠ G83), C192 (= C85), C227 (= C119)
Sites not aligning to the query:
- binding fe3-s4 cluster: 17, 18, 19, 20, 22, 241, 263, 265, 268
- binding protoporphyrin ix containing fe: 88, 89
- binding iron/sulfur cluster: 26, 30, 41, 42, 232, 243, 244, 246, 247, 257, 259
P11349 Respiratory nitrate reductase 1 beta chain; Nitrate reductase A subunit beta; Quinol-nitrate oxidoreductase subunit beta; EC 1.7.5.1 from Escherichia coli (strain K12) (see 2 papers)
32% identity, 67% coverage: 36:121/128 of query aligns to 146:229/512 of P11349
- C184 (≠ E76) binding
- C187 (= C79) binding
- C192 (= C85) binding
- C196 (= C89) binding
- C217 (= C109) binding
- C223 (= C115) binding
- C227 (= C119) binding
Sites not aligning to the query:
- 16 binding
- 19 binding
- 22 binding
- 26 binding
- 244 binding
- 247 binding
- 259 binding
- 263 binding
6x6uB Wor5 from pyrococcus furiosus, taurine-bound (see paper)
47% identity, 33% coverage: 79:120/128 of query aligns to 52:96/167 of 6x6uB
- binding iron/sulfur cluster: C52 (= C79), V53 (= V80), C55 (= C82), P59 (≠ A84), C60 (= C85), C64 (= C89), P65 (= P90), L69 (≠ Y94), C85 (= C109), I86 (= I110), T87 (≠ Q111), C88 (= C112), G89 (= G113), C91 (= C115), C95 (= C119)
Sites not aligning to the query:
- binding phosphate ion: 10, 128, 130, 161, 162
- binding iron/sulfur cluster: 12, 13, 15, 16, 18, 22, 26, 36, 37, 39, 100, 112, 113, 114, 115, 119, 121, 125, 130, 133
8oh5C Cryo-em structure of the electron bifurcating transhydrogenase stnabc complex from sporomusa ovata (state 2) (see paper)
35% identity, 41% coverage: 72:123/128 of query aligns to 606:670/1172 of 8oh5C
- binding iron/sulfur cluster: C613 (= C79), V614 (= V80), L615 (≠ E81), C616 (= C82), G617 (= G83), C619 (= C85), C623 (= C89), I643 (vs. gap), C656 (= C109), I657 (= I110), S658 (≠ Q111), C659 (= C112), G660 (= G113), C662 (= C115), C666 (= C119), G669 (= G122), A670 (= A123)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 199, 201, 202, 203, 222, 223, 229, 230, 235, 239, 264, 265, 285, 288, 332, 471, 477, 479
- binding fe2/s2 (inorganic) cluster: 36, 45, 47, 48, 50, 64
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: 330, 331, 332, 333, 353, 354, 355, 432, 433, 434, 477
- binding iron/sulfur cluster: 96, 98, 100, 102, 104, 108, 147, 149, 151, 155, 156, 164, 170, 480, 562, 563, 565, 567, 573, 692, 694, 695, 699, 725, 727, 728, 853
7z0sF Structure of the escherichia coli formate hydrogenlyase complex (anaerobic preparation, without formate dehydrogenase h) (see paper)
27% identity, 61% coverage: 51:128/128 of query aligns to 1:93/164 of 7z0sF
- binding iron/sulfur cluster: C39 (= C79), I40 (≠ V80), C42 (= C82), A43 (≠ G83), A44 (= A84), C45 (= C85), C49 (= C89), P50 (= P90), A53 (≠ V93), L54 (≠ Y94), W67 (= W100), F69 (≠ L102), C74 (= C109), I75 (= I110), F76 (≠ Q111), C77 (= C112), G78 (= G113), C80 (= C115), C84 (= C119), P85 (= P120), A88 (= A123), I89 (≠ L124)
Sites not aligning to the query:
Query Sequence
>WP_048065229.1 NCBI__GCF_000007345.1:WP_048065229.1
MKIKICIPTERIQNPIISETIVETGILLNIMVANIDSTYGELIADVKDSRFARIKKALES
RGAIVAILDRPIHRDEEECVECGACISVCPMNVYSFDETWSLCVDEKKCIQCGMCIKMCP
HGALKLGE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory