Comparing WP_048065580.1 NCBI__GCF_000007345.1:WP_048065580.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
1nsjA Crystal structure of phosphoribosyl anthranilate isomerase from thermotoga maritima (see paper)
34% identity, 93% coverage: 11:232/238 of query aligns to 2:203/205 of 1nsjA
1lbmA Crystal structure of phosphoribosyl anthranilate isomerase (prai) in complex with reduced 1-(o-carboxyphenylamino)-1-deoxyribulose 5- phosphate (rcdrp) (see paper)
32% identity, 93% coverage: 11:232/238 of query aligns to 2:192/194 of 1lbmA
7etxA Crystal structure of bifunctional indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase (trpc) from corynebacterium glutamicum (see paper)
28% identity, 95% coverage: 14:238/238 of query aligns to 261:472/472 of 7etxA
Sites not aligning to the query:
7etyA Crystal structure of bifunctional indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase (trpc) from corynebacterium glutamicum in complex with reduced 1-(o-carboxyphenylamino)-1- deoxyribulose 5-phosphate (rcdrp) (see paper)
28% identity, 95% coverage: 14:238/238 of query aligns to 259:470/470 of 7etyA
Sites not aligning to the query:
>WP_048065580.1 NCBI__GCF_000007345.1:WP_048065580.1
MKTRPKTRIKTRVKICGIRSPKDIEFAALYGADAVGFITEVPVESPRKLDSDTAAALISK
VPKCLDSVMVIMPETSTSALELIEKVKPNIVQIHSDLPLSELKAVREKADIPIIKTLSVP
AEQEAPKLHNIVTRLLEEVRELEESGIVDSVLLDSGIAGKTGGTGCVHDWDLSRRIAEET
ELPLILAGGLKPENVQEAIRSVSPYAVDTASGVETQGKKDSVKVRKFIEEVRCTYAFL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory