Comparing WP_048081385.1 NCBI__GCF_000745485.1:WP_048081385.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8a6tC Cryo-em structure of the electron bifurcating fe-fe hydrogenase hydabc complex from thermoanaerobacter kivui in the reduced state (see paper)
51% identity, 92% coverage: 3:146/156 of query aligns to 5:148/151 of 8a6tC
O52681 Bifurcating [FeFe] hydrogenase gamma subunit; Hydrogenase (NAD(+), ferredoxin) gamma subunit; Iron-hydrogenase gamma subunit; EC 1.12.1.4 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
48% identity, 98% coverage: 3:155/156 of query aligns to 6:158/161 of O52681
7t2rC Structure of electron bifurcating ni-fe hydrogenase complex hydabcsl in fmn-free apo state (see paper)
47% identity, 93% coverage: 3:147/156 of query aligns to 6:150/152 of 7t2rC
7p5hC Tmhydabc- d2 map (see paper)
48% identity, 98% coverage: 3:155/156 of query aligns to 3:155/156 of 7p5hC
8oh5A Cryo-em structure of the electron bifurcating transhydrogenase stnabc complex from sporomusa ovata (state 2) (see paper)
42% identity, 91% coverage: 5:146/156 of query aligns to 6:147/150 of 8oh5A
8a5eC Cryo-em structure of the electron bifurcating fe-fe hydrogenase hydabc complex from acetobacterium woodii in the reduced state (see paper)
37% identity, 93% coverage: 3:147/156 of query aligns to 11:155/156 of 8a5eC
6tg9G Cryo-em structure of nadh reduced form of NAD+-dependent formate dehydrogenase from rhodobacter capsulatus (see paper)
35% identity, 88% coverage: 4:141/156 of query aligns to 5:140/148 of 6tg9G
8eswV2 NADH dehydrogenase (Ubiquinone) 24 kDa subunit, isoform A (see paper)
34% identity, 94% coverage: 4:150/156 of query aligns to 27:175/214 of 8eswV2
8b9zE Drosophila melanogaster complex i in the active state (dm1) (see paper)
34% identity, 94% coverage: 4:150/156 of query aligns to 27:175/214 of 8b9zE
5gupE structure of mammalian respiratory supercomplex I1III2IV1 (see paper)
36% identity, 94% coverage: 4:150/156 of query aligns to 40:188/197 of 5gupE
7dgq9 NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial (see paper)
36% identity, 94% coverage: 4:150/156 of query aligns to 23:171/207 of 7dgq9
Sites not aligning to the query:
P19404 NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial; NDUFV2; NADH-ubiquinone oxidoreductase 24 kDa subunit; EC 7.1.1.2 from Homo sapiens (Human) (see 2 papers)
36% identity, 94% coverage: 4:150/156 of query aligns to 62:210/249 of P19404
Sites not aligning to the query:
P04394 NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial; NADH dehydrogenase subunit II; NADH-ubiquinone oxidoreductase 24 kDa subunit; EC 7.1.1.2 from Bos taurus (Bovine) (see 2 papers)
36% identity, 94% coverage: 4:150/156 of query aligns to 62:210/249 of P04394
Sites not aligning to the query:
7v2cO Active state complex i from q10 dataset (see paper)
36% identity, 94% coverage: 4:150/156 of query aligns to 30:178/217 of 7v2cO
Q9D6J6 NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial; NADH-ubiquinone oxidoreductase 24 kDa subunit; EC 7.1.1.2 from Mus musculus (Mouse) (see paper)
36% identity, 87% coverage: 15:150/156 of query aligns to 74:209/248 of Q9D6J6
3iam2 Crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus, reduced, 2 mol/asu, with bound nadh (see paper)
36% identity, 83% coverage: 2:131/156 of query aligns to 7:138/179 of 3iam2
3i9v2 Crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus, oxidized, 2 mol/asu (see paper)
36% identity, 83% coverage: 2:131/156 of query aligns to 6:137/178 of 3i9v2
Q56221 NADH-quinone oxidoreductase subunit 2; NADH dehydrogenase I chain 2; NDH-1 subunit 2; EC 7.1.1.- from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see 2 papers)
36% identity, 83% coverage: 2:131/156 of query aligns to 8:139/181 of Q56221
Sites not aligning to the query:
9fdkC Crystal structure of oxidized nuoef variant r66g(nuof) from aquifex aeolicus (see paper)
35% identity, 90% coverage: 1:141/156 of query aligns to 12:155/160 of 9fdkC
7zmbH Cryoem structure of mitochondrial complex i from chaetomium thermophilum (state 2) (see paper)
34% identity, 92% coverage: 2:145/156 of query aligns to 26:173/221 of 7zmbH
>WP_048081385.1 NCBI__GCF_000745485.1:WP_048081385.1
MEDKLNEILSSYKGEKSELIPILQDIQSNYGYLPEDIIVELSNFLKMPESEIYGVATFYS
QFRFTPVGKKHIMVCTGTACHVQGAPQILAGIERHLGIKEGEVTTDLEYSLESVGCLGCC
ALAPCAMVNDEVESHISLKNIKRLFKRKKSKEKASN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory