SitesBLAST
Comparing WP_048192698.1 NCBI__GCF_000223395.1:WP_048192698.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P9WG59 Threonine synthase; TS; EC 4.2.3.1 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
51% identity, 81% coverage: 55:388/413 of query aligns to 19:338/360 of P9WG59
- K69 (= K111) modified: N6-(pyridoxal phosphate)lysine
- N95 (= N137) binding
- K151 (≠ D193) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
- GNAGN 196:200 (≠ GNGGN 238:242) binding
- T326 (= T376) binding
2d1fA Structure of mycobacterium tuberculosis threonine synthase (see paper)
51% identity, 81% coverage: 55:388/413 of query aligns to 10:329/349 of 2d1fA
- active site: K60 (= K111), T84 (= T135), D209 (= D260), R213 (= R264), L215 (≠ V266), A240 (= A299), T317 (= T376)
- binding pyridoxal-5'-phosphate: F59 (= F110), K60 (= K111), N86 (= N137), V186 (= V237), G187 (= G238), N188 (= N239), A189 (≠ G240), G190 (= G241), N191 (= N242), A240 (= A299), T317 (= T376)
A0R220 Threonine synthase; TS; EC 4.2.3.1 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
50% identity, 81% coverage: 55:388/413 of query aligns to 19:338/360 of A0R220
- K151 (≠ D193) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
3aexA Catalytic intermediate analogue of threonine synthase from thermus thermophilus hb8 (see paper)
51% identity, 80% coverage: 52:383/413 of query aligns to 6:324/351 of 3aexA
- active site: K61 (= K111), T85 (= T135), P212 (= P263), G216 (= G267), Q218 (= Q269), A240 (= A299), T317 (= T376)
- binding (3E)-4-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}-2-oxobut-3-enoic acid: K61 (= K111), S84 (= S134), T85 (= T135), N87 (= N137), T88 (= T138), V186 (= V237), G187 (= G238), N188 (= N239), A189 (≠ G240), G190 (= G241), N191 (= N242), A240 (= A299), I241 (= I300), E287 (= E346), T317 (= T376)
- binding phosphate ion: K61 (= K111), T88 (= T138), N154 (= N206), S155 (= S207), R160 (= R212), N188 (= N239)
1v7cA Crystal structure of threonine synthase from thermus thermophilus hb8 in complex with a substrate analogue (see paper)
51% identity, 80% coverage: 52:383/413 of query aligns to 6:324/351 of 1v7cA
- active site: K61 (= K111), T85 (= T135), P212 (= P263), G216 (= G267), Q218 (= Q269), A240 (= A299), T317 (= T376)
- binding (2e)-2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]-5-phosphonopent-2-enoic acid: K61 (= K111), S84 (= S134), T85 (= T135), N87 (= N137), T88 (= T138), F134 (= F184), N154 (= N206), S155 (= S207), R160 (= R212), V186 (= V237), G187 (= G238), N188 (= N239), A189 (≠ G240), G190 (= G241), N191 (= N242), A240 (= A299), I241 (= I300), E287 (= E346), T317 (= T376)
3aeyA Apo form of threonine synthase from thermus thermophilus hb8 (see paper)
51% identity, 80% coverage: 52:383/413 of query aligns to 5:323/350 of 3aeyA
- active site: K60 (= K111), T84 (= T135), P211 (= P263), G215 (= G267), Q217 (= Q269), A239 (= A299), T316 (= T376)
- binding sulfate ion: K60 (= K111), K60 (= K111), G85 (= G136), N86 (= N137), T87 (= T138), T87 (= T138), S154 (= S207), R159 (= R212), N187 (= N239), R228 (≠ K286), V230 (= V290), E231 (≠ D291), R232 (≠ K292), A239 (= A299)
1uimA Crystal structure of threonine synthase from thermus thermophilus hb8, orthorhombic crystal form (see paper)
51% identity, 80% coverage: 52:383/413 of query aligns to 6:324/350 of 1uimA
- active site: K61 (= K111), T85 (= T135), P212 (= P263), G216 (= G267), Q218 (= Q269), A240 (= A299), T317 (= T376)
- binding pyridoxal-5'-phosphate: F60 (= F110), K61 (= K111), N87 (= N137), G187 (= G238), N188 (= N239), A189 (≠ G240), G190 (= G241), N191 (= N242), A240 (= A299), E287 (= E346), T317 (= T376), G318 (= G377)
2zsjA Crystal structure of threonine synthase from aquifex aeolicus vf5
49% identity, 81% coverage: 54:388/413 of query aligns to 8:329/350 of 2zsjA
- active site: K61 (= K111), T85 (= T135), Q218 (= Q269), A222 (= A273), A240 (= A299), T317 (= T376)
- binding pyridoxal-5'-phosphate: F60 (= F110), K61 (= K111), N87 (= N137), V186 (= V237), G187 (= G238), N188 (= N239), A189 (≠ G240), G190 (= G241), N191 (= N242), A240 (= A299), T317 (= T376), G318 (= G377)
6nmxA Threonine synthase from bacillus subtilis atcc 6633 with plp and appa (see paper)
46% identity, 84% coverage: 43:390/413 of query aligns to 2:329/350 of 6nmxA
- active site: K60 (= K111), T84 (= T135), E216 (≠ Q269), S220 (≠ A273), A238 (= A299), T315 (= T376)
- binding (2E,3Z)-2-{[(Z)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4(1H)-ylidene}methyl]imino}-5-phosphonopent-3-enoic acid: K60 (= K111), S83 (= S134), T84 (= T135), N86 (= N137), T87 (= T138), F133 (= F184), N153 (= N206), S154 (= S207), R159 (= R212), V185 (= V237), G186 (= G238), N187 (= N239), A188 (≠ G240), G189 (= G241), N190 (= N242), A238 (= A299), I239 (= I300), E285 (= E346), T315 (= T376)
6cgqB Threonine synthase from bacillus subtilis atcc 6633 with plp and plp- ala (see paper)
47% identity, 82% coverage: 52:390/413 of query aligns to 5:327/345 of 6cgqB
- active site: K58 (= K111), T82 (= T135), E214 (≠ Q269), S218 (≠ A273), A236 (= A299), T313 (= T376)
- binding (E)-N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)-L-alanine: K58 (= K111), S81 (= S134), T82 (= T135), N84 (= N137), T85 (= T138), V183 (= V237), G184 (= G238), N185 (= N239), A186 (≠ G240), N188 (= N242), A236 (= A299), I237 (= I300), E283 (= E346), T313 (= T376)
- binding phosphate ion: K58 (= K111), T85 (= T138), N151 (= N206), S152 (= S207), R157 (= R212), N185 (= N239)
6cgqA Threonine synthase from bacillus subtilis atcc 6633 with plp and plp- ala (see paper)
46% identity, 82% coverage: 52:390/413 of query aligns to 3:319/339 of 6cgqA
- active site: K56 (= K111), T80 (= T135), E206 (≠ Q269), S210 (≠ A273), A228 (= A299), T305 (= T376)
- binding pyridoxal-5'-phosphate: F55 (= F110), K56 (= K111), N82 (= N137), V175 (= V237), G176 (= G238), N177 (= N239), A178 (≠ G240), G179 (= G241), N180 (= N242), A228 (= A299), E275 (= E346), T305 (= T376), G306 (= G377)
Q9S7B5 Threonine synthase 1, chloroplastic; Protein METHIONINE OVER-ACCUMULATOR 2; EC 4.2.3.1 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
36% identity, 89% coverage: 15:381/413 of query aligns to 94:477/526 of Q9S7B5
- N172 (≠ P76) binding
- L173 (= L77) binding
- K181 (≠ V93) binding in monomer B; binding in monomer A
- N187 (≠ P95) binding in monomer B
- L205 (≠ R113) mutation to R: In mto2-1; causes a strong decrease in the concentration of soluble threonine and over-accumulation of methionine.
2c2bA Crystallographic structure of arabidopsis thaliana threonine synthase complexed with pyridoxal phosphate and s-adenosylmethionine (see paper)
36% identity, 89% coverage: 15:381/413 of query aligns to 19:402/444 of 2c2bA
- binding pyridoxal-5'-phosphate: F127 (= F110), K128 (= K111), D159 (≠ N137), G259 (≠ V237), G260 (= G238), N261 (= N239), L262 (≠ G240), G263 (= G241), N264 (= N242), A321 (= A299), H369 (≠ A348), T397 (= T376)
- binding s-adenosylmethionine: S64 (vs. gap), T65 (vs. gap), W66 (vs. gap), P67 (vs. gap), G69 (= G49), S90 (≠ T69), F92 (≠ G71), N97 (≠ P76), L98 (= L77), W100 (≠ R79), W115 (≠ Y98), W115 (≠ Y98), Q246 (≠ E226), F247 (≠ I227)
2c2gA Crystal structure of threonine synthase from arabidopsis thaliana in complex with its cofactor pyridoxal phosphate (see paper)
34% identity, 89% coverage: 15:381/413 of query aligns to 37:404/448 of 2c2gA
2gn2A Crystal structure of tetrameric biodegradative threonine deaminase (tdcb) from salmonella typhimurium in complex with cmp at 2.5a resolution (hexagonal form) (see paper)
31% identity, 68% coverage: 97:378/413 of query aligns to 42:312/326 of 2gn2A
- active site: K56 (= K111), A81 (≠ T135), Q207 (= Q269), V211 (≠ A273), G213 (≠ P275), G235 (≠ A299), I308 (≠ V374), S309 (≠ A375)
- binding cytidine-5'-monophosphate: R51 (≠ P106), T52 (= T107), G53 (= G108), A114 (≠ Q169), D117 (≠ L172), Y118 (= Y173), N312 (≠ H378)
P04968 L-threonine dehydratase biosynthetic IlvA; Threonine deaminase; EC 4.3.1.19 from Escherichia coli (strain K12) (see paper)
30% identity, 71% coverage: 67:360/413 of query aligns to 24:300/514 of P04968
- K62 (= K111) modified: N6-(pyridoxal phosphate)lysine
- N89 (= N137) binding
- GGGGL 188:192 (≠ GNGGN 238:242) binding
Sites not aligning to the query:
1tdjA Threonine deaminase (biosynthetic) from e. Coli (see paper)
30% identity, 71% coverage: 67:360/413 of query aligns to 20:296/494 of 1tdjA
- active site: K58 (= K111), A83 (≠ T135), E209 (≠ Q269), S213 (≠ A273), C215 (≠ P275), G237 (≠ T295)
- binding pyridoxal-5'-phosphate: F57 (= F110), K58 (= K111), N85 (= N137), G184 (= G238), G185 (≠ N239), G186 (= G240), G187 (= G241), G237 (≠ T295), E282 (= E346)
Sites not aligning to the query:
Q7XSN8 Serine racemase; D-serine dehydratase; D-serine ammonia-lyase; L-serine dehydratase; L-serine ammonia-lyase; EC 5.1.1.18; EC 4.3.1.18; EC 4.3.1.17 from Oryza sativa subsp. japonica (Rice) (see paper)
28% identity, 69% coverage: 75:357/413 of query aligns to 38:302/339 of Q7XSN8
- E219 (≠ Q269) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-225.
- D225 (≠ P275) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-219.
6zspAAA serine racemase bound to atp and malonate. (see paper)
27% identity, 63% coverage: 96:357/413 of query aligns to 38:284/320 of 6zspAAA
- active site: K53 (= K111), S74 (≠ T135), E200 (≠ G272), A204 (≠ L276), D206 (≠ T278), G229 (≠ A299)
- binding adenosine-5'-triphosphate: K48 (≠ P106), T49 (= T107), Q79 (≠ S140), Y111 (= Y173), E266 (≠ S339), R267 (≠ M340), K269 (≠ G342)
- binding magnesium ion: E200 (≠ G272), A204 (≠ L276), D206 (≠ T278)
- binding malonate ion: K53 (= K111), S73 (= S134), S74 (≠ T135), N76 (= N137), H77 (≠ T138), R125 (≠ M188), G229 (≠ A299), S232 (≠ I302)
Sites not aligning to the query:
3l6bA X-ray crystal structure of human serine racemase in complex with malonate a potent inhibitor (see paper)
26% identity, 63% coverage: 96:357/413 of query aligns to 39:287/322 of 3l6bA
- active site: K54 (= K111), S77 (≠ T135), E203 (≠ G272), A207 (≠ L276), D209 (≠ T278), G232 (≠ A299), T278 (≠ A348)
- binding malonate ion: K54 (= K111), S76 (= S134), S77 (≠ T135), N79 (= N137), H80 (≠ T138), R128 (≠ M188), G232 (≠ A299)
- binding manganese (ii) ion: E203 (≠ G272), A207 (≠ L276), D209 (≠ T278)
- binding pyridoxal-5'-phosphate: F53 (= F110), K54 (= K111), N79 (= N137), G178 (= G238), G179 (≠ N239), G180 (= G240), G181 (= G241), M182 (≠ N242), V233 (≠ I300), E276 (= E346), T278 (≠ A348)
Sites not aligning to the query:
Query Sequence
>WP_048192698.1 NCBI__GCF_000223395.1:WP_048192698.1
MFRRGVVLRCVNCGEIYEPDPFLFKCRKCGSLLEVLVPVEGVSWSSFRGRGVWRYRPLLP
VSDDVKPVTMGEGGTPLIRCENIEAWLRDRYGVAPRVYVKFEGANPTGSFKDRGMTVIAS
IARSLRVKLVAAASTGNTASSAAAYTARAGLKMVLVLPKGKVAKGKLGQSILYGATIIEV
DGSFDDAMKAVQDAVEASKGGIYPFNSFNPWRLEGQKTIAFEIAEEIGVPDFVIVPVGNG
GNISAIWKGFNELHKAGLIDKLPRMVGVQAEGAAPLATAFEKGLDKPLFVDKPETVATAI
RIGRPVNWMKALRAVKESGGLFTKVSDDEILSAMRMLASMEGVGAEPAGASSLAGLLKLV
EDGTIGNNDTVVLVATGHALKDPDAMLRASTKMLHASSSSEAAKLLLEMAEKS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory