SitesBLAST
Comparing WP_049754094.1 NCBI__GCF_000019165.1:WP_049754094.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9S400 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) (see paper)
51% identity, 95% coverage: 20:439/443 of query aligns to 10:424/427 of Q9S400
1rf6A Structural studies of streptococcus pneumoniae epsp synthase in s3p- glp bound state (see paper)
51% identity, 95% coverage: 20:439/443 of query aligns to 10:424/427 of 1rf6A
- active site: K20 (= K30), S21 (= S31), D47 (= D57), N90 (= N101), D115 (≠ T126), R120 (= R131), D312 (= D328), E340 (= E356), H384 (= H400), R385 (= R401), T412 (≠ V427)
- binding glyphosate: K20 (= K30), G92 (= G103), T93 (= T104), R120 (= R131), Q168 (= Q180), D312 (= D328), E340 (= E356), R343 (= R359), H384 (= H400), R385 (= R401)
- binding shikimate-3-phosphate: S21 (= S31), R25 (= R35), S166 (= S178), Q168 (= Q180), R193 (= R205), I311 (= I327), D312 (= D328), K339 (= K355)
1rf4A Structural studies of streptococcus pneumoniae epsp synthase, tetrahedral intermediate bound state (see paper)
51% identity, 95% coverage: 20:439/443 of query aligns to 10:424/427 of 1rf4A
- active site: K20 (= K30), S21 (= S31), D47 (= D57), N90 (= N101), D115 (≠ T126), R120 (= R131), D312 (= D328), E340 (= E356), H384 (= H400), R385 (= R401), T412 (≠ V427)
- binding (3r,4s,5r)-5-{[(1r)-1-carboxy-2-fluoro-1-(phosphonooxy)ethyl]oxy}-4-hydroxy-3-(phosphonooxy)cyclohex-1-ene-1-carboxylic acid: K20 (= K30), S21 (= S31), R25 (= R35), G92 (= G103), T93 (= T104), R120 (= R131), S166 (= S178), A167 (= A179), Q168 (= Q180), R193 (= R205), D312 (= D328), K339 (= K355), E340 (= E356), R343 (= R359), H384 (= H400), R385 (= R401)
Q83E11 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
49% identity, 95% coverage: 16:435/443 of query aligns to 7:421/438 of Q83E11
- KS 21:22 (= KS 30:31) binding
- R26 (= R35) binding
- NSGT 93:96 (= NSGT 101:104) Phosphoenolpyruvate
- R123 (= R131) binding
- D315 (= D328) active site, Proton acceptor
- K342 (= K355) binding
- R346 (= R359) binding
- R387 (= R401) binding
3slhD 1.70 angstrom resolution structure of 3-phosphoshikimate 1- carboxyvinyltransferase (aroa) from coxiella burnetii in complex with shikimate-3-phosphate and glyphosate
49% identity, 95% coverage: 16:435/443 of query aligns to 9:423/440 of 3slhD
- active site: K23 (= K30), S24 (= S31), D50 (= D57), N95 (= N101), R125 (= R131), D317 (= D328), E345 (= E356), H388 (= H400), R389 (= R401), T415 (≠ V427)
- binding glyphosate: K23 (= K30), G97 (= G103), T98 (= T104), R125 (= R131), Q171 (= Q180), D317 (= D328), E345 (= E356), R348 (= R359), H388 (= H400), R389 (= R401)
- binding shikimate-3-phosphate: S24 (= S31), R28 (= R35), S169 (= S178), Q171 (= Q180), R196 (= R205), D317 (= D328), K344 (= K355)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S24 (= S31), R28 (= R35), T98 (= T104), Q171 (= Q180), R196 (= R205), D317 (= D328), K344 (= K355)
4egrA 2.50 angstrom resolution structure of 3-phosphoshikimate 1- carboxyvinyltransferase (aroa) from coxiella burnetii in complex with phosphoenolpyruvate
49% identity, 95% coverage: 16:435/443 of query aligns to 9:419/434 of 4egrA
- active site: K23 (= K30), S24 (= S31), D50 (= D57), N95 (= N101), R125 (= R131), D313 (= D328), E341 (= E356), H384 (= H400), R385 (= R401), T411 (≠ V427)
- binding phosphoenolpyruvate: K23 (= K30), G97 (= G103), T98 (= T104), R125 (= R131), D313 (= D328), E341 (= E356), R344 (= R359), R385 (= R401)
Q9R4E4 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Agrobacterium sp. (strain CP4) (see 2 papers)
45% identity, 95% coverage: 20:439/443 of query aligns to 18:443/455 of Q9R4E4
- KS 28:29 (= KS 30:31) binding
- R33 (= R35) binding
- NAAT 98:101 (≠ NSGT 101:104) Phosphoenolpyruvate
- A100 (≠ G103) mutation to G: Confers resistance to glyphosate.
- R128 (= R131) binding
- K353 (= K355) binding
- R357 (= R359) binding
- R405 (= R401) binding
2pqcA Cp4 epsps liganded with (r)-phosphonate tetrahedral reaction intermediate analog (see paper)
45% identity, 95% coverage: 20:439/443 of query aligns to 13:438/445 of 2pqcA
- active site: K23 (= K30), S24 (= S31), D50 (= D57), N93 (= N101), R123 (= R131), D321 (= D328), E349 (= E356), H399 (= H400), R400 (= R401), T426 (≠ V427)
- binding [3r-[3a,4a,5b(r*)]]-5-(1-carboxy-1-phosphonoethoxy)-4-hydroxy-3-(phosphonooxy)-1-cyclohexene-1-carboxylic acid: K23 (= K30), S24 (= S31), R28 (= R35), T96 (= T104), R123 (= R131), S168 (= S178), Q170 (= Q180), D321 (= D328), K348 (= K355), E349 (= E356), R352 (= R359), R400 (= R401)
2pqbA Cp4 epsps liganded with (r)-difluoromethyl tetrahedral intermediate analog (see paper)
45% identity, 95% coverage: 20:439/443 of query aligns to 13:438/445 of 2pqbA
- active site: K23 (= K30), S24 (= S31), D50 (= D57), N93 (= N101), R123 (= R131), D321 (= D328), E349 (= E356), H399 (= H400), R400 (= R401), T426 (≠ V427)
- binding (3r,4s,5r)-5-[(1r)-1-carboxy-2,2-difluoro-1-(phosphonooxy)ethoxy]-4-hydroxy-3-(phosphonooxy)cyclohex-1-ene-1-carboxylic acid: K23 (= K30), S24 (= S31), R28 (= R35), A95 (≠ G103), T96 (= T104), R123 (= R131), S168 (= S178), Q170 (= Q180), D321 (= D328), K348 (= K355), E349 (= E356), R352 (= R359), R400 (= R401)
2ggaA Cp4 epsp synthase liganded with s3p and glyphosate (see paper)
45% identity, 95% coverage: 20:439/443 of query aligns to 13:438/445 of 2ggaA
- active site: K23 (= K30), S24 (= S31), D50 (= D57), N93 (= N101), R123 (= R131), D321 (= D328), E349 (= E356), H399 (= H400), R400 (= R401), T426 (≠ V427)
- binding glyphosate: K23 (= K30), A94 (≠ S102), A95 (≠ G103), T96 (= T104), R123 (= R131), D321 (= D328), E349 (= E356), R352 (= R359), R400 (= R401)
- binding shikimate-3-phosphate: S24 (= S31), R28 (= R35), S168 (= S178), A169 (= A179), Q170 (= Q180), R195 (= R205), D321 (= D328), K348 (= K355)
2gg6A Cp4 epsp synthase liganded with s3p (see paper)
45% identity, 95% coverage: 20:439/443 of query aligns to 13:438/445 of 2gg6A
- active site: K23 (= K30), S24 (= S31), D50 (= D57), N93 (= N101), R123 (= R131), D321 (= D328), E349 (= E356), H399 (= H400), R400 (= R401), T426 (≠ V427)
- binding shikimate-3-phosphate: S24 (= S31), R28 (= R35), T96 (= T104), S168 (= S178), Q170 (= Q180), D321 (= D328), K348 (= K355)
3nvsA 1.02 angstrom resolution crystal structure of 3-phosphoshikimate 1- carboxyvinyltransferase from vibrio cholerae in complex with shikimate-3-phosphate (partially photolyzed) and glyphosate
31% identity, 98% coverage: 9:441/443 of query aligns to 1:426/426 of 3nvsA
- active site: K22 (= K30), S23 (= S31), D49 (= D57), N94 (= N101), P119 (≠ T126), R124 (= R131), H128 (≠ R135), Q135 (≠ E142), Y142 (≠ G149), E144 (= E151), A247 (= A250), A255 (≠ S258), D314 (= D328), E342 (= E356), H386 (= H400), R387 (= R401), K412 (≠ V427)
- binding glyphosate: K22 (= K30), G96 (= G103), R124 (= R131), Q172 (= Q180), D314 (= D328), E342 (= E356), R345 (= R359), H386 (= H400), R387 (= R401)
- binding magnesium ion: E123 (≠ R130), Q145 (≠ N152)
- binding shikimate-3-phosphate: K22 (= K30), S23 (= S31), R27 (= R35), T97 (= T104), S170 (≠ A177), S171 (= S178), Q172 (= Q180), S198 (= S204), Y201 (vs. gap), D314 (= D328), N337 (≠ E351), K341 (= K355)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S23 (= S31), R27 (= R35), Q172 (= Q180), Y201 (vs. gap), D314 (= D328), K341 (= K355)
Q9KRB0 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
31% identity, 98% coverage: 9:441/443 of query aligns to 1:426/426 of Q9KRB0
P11043 3-phosphoshikimate 1-carboxyvinyltransferase, chloroplastic; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EC 2.5.1.19 from Petunia hybrida (Petunia) (see paper)
29% identity, 97% coverage: 12:442/443 of query aligns to 77:516/516 of P11043
- G173 (= G103) mutation to A: Resistance to glyphosate due to a lower affinity. Slight reduction in EPSP synthase activity.
7tm5B Crystal structure of shikimate-3-phosphate bound 3-phosphoshikimate 1- carboxyvinyltransferase from klebsiella pneumoniae
30% identity, 97% coverage: 9:439/443 of query aligns to 1:423/427 of 7tm5B
- binding shikimate-3-phosphate: K22 (= K30), S23 (= S31), R27 (= R35), S169 (≠ A177), S170 (= S178), Q171 (= Q180), S197 (= S204), Y200 (vs. gap), D313 (= D328), N336 (≠ E351), K340 (= K355)
7tm6A Crystal structure of shikimate-3-phosphate and glyphosate bound 3- phosphoshikimate 1-carboxyvinyltransferase from klebsiella pneumoniae
30% identity, 97% coverage: 10:439/443 of query aligns to 1:422/426 of 7tm6A
- binding glyphosate: K21 (= K30), G95 (= G103), R123 (= R131), Q170 (= Q180), D312 (= D328), E340 (= E356), R343 (= R359), H384 (= H400), R385 (= R401)
- binding shikimate-3-phosphate: S22 (= S31), R26 (= R35), T96 (= T104), S168 (≠ A177), S169 (= S178), Q170 (= Q180), S196 (= S204), Y199 (vs. gap), D312 (= D328), N335 (≠ E351), K339 (= K355)
7m0oA Dgt-28 epsps (see paper)
30% identity, 94% coverage: 26:441/443 of query aligns to 2:399/400 of 7m0oA
6hqvA Pentafunctional arom complex from chaetomium thermophilum (see paper)
29% identity, 97% coverage: 11:441/443 of query aligns to 387:829/1555 of 6hqvA
Sites not aligning to the query:
- active site: 123, 145, 187, 243, 253, 257, 261, 264, 268, 280
- binding (4S,5R)-4,5-dihydroxy-3-oxocyclohex-1-ene-1-carboxylic acid: 1060, 1062, 1181, 1224, 1232, 1242, 1243
- binding glutamic acid: 139, 145, 187, 243, 257, 264, 280
- binding nicotinamide-adenine-dinucleotide: 42, 44, 45, 76, 79, 107, 108, 109, 112, 132, 133, 135, 139, 140, 145, 154, 175, 176, 177, 180, 280
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: 874, 923, 924, 979, 1277, 1279, 1323, 1327, 1348, 1368, 1526
- binding zinc ion: 187, 264, 280
2pq9A E. Coli epsps liganded with (r)-difluoromethyl tetrahedral reaction intermediate analog (see paper)
29% identity, 98% coverage: 9:443/443 of query aligns to 1:427/427 of 2pq9A
- active site: K22 (= K30), S23 (= S31), D49 (= D57), N94 (= N101), P119 (≠ T126), R124 (= R131), D313 (= D328), E341 (= E356), H385 (= H400), R386 (= R401), K411 (≠ V427)
- binding (3r,4s,5r)-5-[(1r)-1-carboxy-2,2-difluoro-1-(phosphonooxy)ethoxy]-4-hydroxy-3-(phosphonooxy)cyclohex-1-ene-1-carboxylic acid: K22 (= K30), S23 (= S31), R27 (= R35), G96 (= G103), T97 (= T104), R124 (= R131), S169 (≠ A177), S170 (= S178), Q171 (= Q180), S197 (= S204), Y200 (vs. gap), D313 (= D328), N336 (≠ E351), K340 (= K355), R344 (= R359), H385 (= H400), R386 (= R401), K411 (≠ V427)
2aa9A Epsp synthase liganded with shikimate (see paper)
29% identity, 98% coverage: 9:443/443 of query aligns to 1:427/427 of 2aa9A
- active site: K22 (= K30), S23 (= S31), D49 (= D57), N94 (= N101), P119 (≠ T126), R124 (= R131), D313 (= D328), E341 (= E356), H385 (= H400), R386 (= R401), K411 (≠ V427)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: K22 (= K30), S23 (= S31), R27 (= R35), T97 (= T104), Q171 (= Q180), Y200 (vs. gap), D313 (= D328), K340 (= K355)
Query Sequence
>WP_049754094.1 NCBI__GCF_000019165.1:WP_049754094.1
MNDVQTAALKSLAIRPGLPLRGETEVPGDKSISHRAVMFGALARGVTRVHRFLPGQDCLS
TIDCFRKLGVRIEQPNPSEVVVYGQGPGGLKEPSEVLDVGNSGTTIRLMTGILSGLPFFS
IVTGDTSIRRRPMGRVTRPLLEMGASIWGRENATKAPLAINGASMALEAIHYNSPVASAQ
VKSAVLLAGLFAEGCTSVREPLVSRDHTERMLAAFGAKIGRSEDRLTASVEGFPELRAQE
VEVPGDISSAAFLLVAASIVPGSELVLYNIGVNPTRDGIIEVLRAMGGDVQVENAREVAG
ELVADLIVRSASLKGTTIGGAIIPRLIDELPIIAVAALFAEGTTEIRDAAEMRVKETDRI
AVMIRELRKLGADIEERPDGMIIRGGAALRGAATESHGDHRVAMALAVAGLLAEGETVIN
DAGSIDVSFPGFAELLERLRRRA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory