Comparing WP_049768148.1 NCBI__GCF_000021745.1:WP_049768148.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
57% identity, 93% coverage: 14:245/249 of query aligns to 6:237/240 of 1ji0A
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
30% identity, 93% coverage: 14:245/249 of query aligns to 4:252/254 of 1g6hA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
30% identity, 93% coverage: 14:245/249 of query aligns to 4:252/253 of 1g9xB
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
33% identity, 96% coverage: 2:239/249 of query aligns to 4:240/378 of P69874
Sites not aligning to the query:
8y5iA Cryo-em structure of e.Coli spermidine transporter potd-potabc in translocation intermidiate state (see paper)
33% identity, 91% coverage: 13:239/249 of query aligns to 1:225/358 of 8y5iA
P0AAH0 Phosphate import ATP-binding protein PstB; ABC phosphate transporter; Phosphate-transporting ATPase; EC 7.3.2.1 from Escherichia coli (strain K12) (see paper)
30% identity, 95% coverage: 3:238/249 of query aligns to 2:243/257 of P0AAH0
Sites not aligning to the query:
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
34% identity, 93% coverage: 15:245/249 of query aligns to 3:234/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
34% identity, 93% coverage: 15:245/249 of query aligns to 3:234/238 of 6s8gA
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
34% identity, 93% coverage: 15:245/249 of query aligns to 3:234/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
34% identity, 93% coverage: 15:245/249 of query aligns to 3:234/234 of 4p31A
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
34% identity, 93% coverage: 15:245/249 of query aligns to 3:234/235 of 6mhzA
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
32% identity, 91% coverage: 15:241/249 of query aligns to 4:228/369 of P19566
Sites not aligning to the query:
6mbnA Lptb e163q in complex with atp (see paper)
34% identity, 93% coverage: 15:245/249 of query aligns to 4:235/241 of 6mbnA
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
31% identity, 93% coverage: 14:245/249 of query aligns to 2:234/240 of 6mjpA
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
34% identity, 92% coverage: 15:244/249 of query aligns to 3:233/233 of 6b8bA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
29% identity, 91% coverage: 13:239/249 of query aligns to 1:228/241 of 4u00A
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
31% identity, 91% coverage: 15:241/249 of query aligns to 3:227/371 of 3puyA
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
31% identity, 91% coverage: 15:241/249 of query aligns to 3:227/371 of 3puxA
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
31% identity, 91% coverage: 15:241/249 of query aligns to 3:227/371 of 3puwA
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
31% identity, 91% coverage: 15:241/249 of query aligns to 3:227/371 of 3puvA
>WP_049768148.1 NCBI__GCF_000021745.1:WP_049768148.1
MSGMMNSGPAAKPLLSLRGVTAYYGAIIALRGVDLDIREGEIVTLIGANGAGKTTLMMTI
FGNPRARDGEIRFAGEDITRLDTHKIARLGLAQSPEGRRIFPRMSVYENLQMGAGVDGGG
HFSEDLERIFAIFPRLKERAGQRGGTLSGGEQQMLAIARALMSRPRLLLLDEPSLGLAPL
VVKQIFEVVRDLNRREGLTVFLVEQNAFHALSLADRAHVMVNGAITLSGAGRELLARPEV
RAAYLEGGA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory