Comparing WP_049774007.1 NCBI__GCF_000015565.1:WP_049774007.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
34% identity, 85% coverage: 11:241/273 of query aligns to 16:246/265 of P07821
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
33% identity, 84% coverage: 16:245/273 of query aligns to 12:240/241 of 4u00A
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
33% identity, 79% coverage: 7:222/273 of query aligns to 4:217/223 of 2pclA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
29% identity, 79% coverage: 9:225/273 of query aligns to 4:218/240 of 4ymuJ
6panA Structure of a bacterial atm1-family abc exporter with atp bound (see paper)
34% identity, 76% coverage: 19:225/273 of query aligns to 344:547/572 of 6panA
Sites not aligning to the query:
4mrvA Structure of a bacterial atm1-family abc transporter (see paper)
34% identity, 76% coverage: 19:225/273 of query aligns to 367:570/600 of 4mrvA
Sites not aligning to the query:
4mrsA Structure of a bacterial atm1-family abc transporter (see paper)
34% identity, 76% coverage: 19:225/273 of query aligns to 367:570/600 of 4mrsA
Sites not aligning to the query:
4mrpA Structure of a bacterial atm1-family abc transporter (see paper)
34% identity, 76% coverage: 19:225/273 of query aligns to 367:570/600 of 4mrpA
Sites not aligning to the query:
4mrnA Structure of a bacterial atm1-family abc transporter (see paper)
34% identity, 76% coverage: 19:225/273 of query aligns to 367:570/600 of 4mrnA
6parA Structure of a bacterial atm1-family abc exporter with mgamppnp bound (see paper)
34% identity, 76% coverage: 19:225/273 of query aligns to 353:556/578 of 6parA
Sites not aligning to the query:
6pamA Structure of a bacterial atm1-family abc transporter with mgadp bound (see paper)
34% identity, 76% coverage: 19:225/273 of query aligns to 362:565/586 of 6pamA
Sites not aligning to the query:
Q2G506 ATM1-type heavy metal exporter; ATP-binding cassette transporter Atm1; NaAtm1; EC 7.-.-.- from Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199) (see paper)
34% identity, 76% coverage: 19:225/273 of query aligns to 374:577/608 of Q2G506
Sites not aligning to the query:
5x40A Structure of a cbio dimer bound with amppcp (see paper)
38% identity, 78% coverage: 17:229/273 of query aligns to 16:226/280 of 5x40A
Sites not aligning to the query:
Q61102 Iron-sulfur clusters transporter ABCB7, mitochondrial; ATP-binding cassette sub-family B member 7, mitochondrial; ATP-binding cassette transporter 7; ABC transporter 7 protein from Mus musculus (Mouse) (see paper)
30% identity, 77% coverage: 16:225/273 of query aligns to 482:688/752 of Q61102
Sites not aligning to the query:
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
30% identity, 77% coverage: 16:225/273 of query aligns to 27:230/378 of P69874
Sites not aligning to the query:
H2LNR5 Iron-sulfur clusters transporter ABCB7, mitochondrial; ATP-binding cassette sub-family B member 7, mitochondrial from Oryzias latipes (Japanese rice fish) (Japanese killifish) (see paper)
28% identity, 80% coverage: 19:236/273 of query aligns to 478:686/746 of H2LNR5
Sites not aligning to the query:
7vgfA Cryo-em structure of amp-pnp bound human abcb7
29% identity, 77% coverage: 16:225/273 of query aligns to 338:544/550 of 7vgfA
Sites not aligning to the query:
O75027 Iron-sulfur clusters transporter ABCB7, mitochondrial; ATP-binding cassette sub-family B member 7, mitochondrial; ATP-binding cassette transporter 7; ABC transporter 7 protein from Homo sapiens (Human) (see 4 papers)
29% identity, 77% coverage: 16:225/273 of query aligns to 482:688/752 of O75027
Sites not aligning to the query:
5ws4A Crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii (see paper)
33% identity, 74% coverage: 20:222/273 of query aligns to 22:222/650 of 5ws4A
A0R6H8 Mycobactin import ATP-binding/permease protein IrtA; EC 7.2.2.- from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
32% identity, 75% coverage: 21:225/273 of query aligns to 624:824/860 of A0R6H8
Sites not aligning to the query:
>WP_049774007.1 NCBI__GCF_000015565.1:WP_049774007.1
MKNPIALGASQLSARIGARQILHGIDLQLPAGRWTSIVGPNGAGKSTLLKALAGLLPRAA
VQGRVQLLGRALAQIPARERARQLAWLGQGEGVTDELTSYDIAMLGRLPHQAWLAPPGPA
DHAAVEQALRATQAWDWRQRPLSQLSGGERQRVLLARALAVQAPVLLLDEPLANLDPPHQ
TDWLHTMRTLVAAGTTVVSVLHEVSLALQADDMVLMAAGRVLHQGRCTAPATHAALEQVF
GQRILVRHLQGMWLALPALGGGQYTPPDTPPGV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory