Comparing WP_050460811.1 NCBI__GCF_001189915.1:WP_050460811.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7rsfA Acetylornithine deacetylase from escherichia coli
34% identity, 83% coverage: 47:368/390 of query aligns to 56:358/380 of 7rsfA
Q8P8J5 N-acetyl-L-citrulline deacetylase; ACDase; Acetylcitrulline deacetylase; EC 3.5.1.- from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) (see paper)
29% identity, 98% coverage: 2:383/390 of query aligns to 7:361/366 of Q8P8J5
2f7vA Structure of acetylcitrulline deacetylase complexed with one co (see paper)
28% identity, 98% coverage: 2:383/390 of query aligns to 8:356/360 of 2f7vA
5vo3A Crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) (see paper)
27% identity, 82% coverage: 63:383/390 of query aligns to 58:374/380 of 5vo3A
P44514 Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 3 papers)
27% identity, 82% coverage: 63:383/390 of query aligns to 54:370/377 of P44514
7lgpB Dape enzyme from shigella flexneri
28% identity, 81% coverage: 71:387/390 of query aligns to 63:375/377 of 7lgpB
7uoiA Crystallographic structure of dape from enterococcus faecium
25% identity, 79% coverage: 63:370/390 of query aligns to 62:364/383 of 7uoiA
7t1qA Crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid
27% identity, 83% coverage: 65:387/390 of query aligns to 56:374/377 of 7t1qA
3pfoA Crystal structure of a putative acetylornithine deacetylase (rpa2325) from rhodopseudomonas palustris cga009 at 1.90 a resolution
25% identity, 73% coverage: 71:355/390 of query aligns to 99:389/426 of 3pfoA
Sites not aligning to the query:
4pqaA Crystal structure of succinyl-diaminopimelate desuccinylase from neisseria meningitidis mc58 in complex with the inhibitor captopril (see paper)
28% identity, 80% coverage: 65:375/390 of query aligns to 56:362/375 of 4pqaA
4o23A Crystal structure of mono-zinc form of succinyl diaminopimelate desuccinylase from neisseria meningitidis mc58 (see paper)
28% identity, 80% coverage: 65:375/390 of query aligns to 56:362/376 of 4o23A
P37111 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Sus scrofa (Pig) (see paper)
28% identity, 54% coverage: 71:281/390 of query aligns to 75:292/407 of P37111
Sites not aligning to the query:
Q03154 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Homo sapiens (Human) (see 6 papers)
27% identity, 55% coverage: 69:281/390 of query aligns to 73:293/408 of Q03154
Sites not aligning to the query:
4h2kA Crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae (see paper)
34% identity, 36% coverage: 65:206/390 of query aligns to 58:195/258 of 4h2kA
Sites not aligning to the query:
3dljA Crystal structure of human carnosine dipeptidase 1
39% identity, 23% coverage: 68:157/390 of query aligns to 93:185/471 of 3dljA
Sites not aligning to the query:
Q96KN2 Beta-Ala-His dipeptidase; CNDP dipeptidase 1; Carnosine dipeptidase 1; Glutamate carboxypeptidase-like protein 2; Serum carnosinase; EC 3.4.13.20 from Homo sapiens (Human) (see 4 papers)
39% identity, 23% coverage: 68:157/390 of query aligns to 124:216/507 of Q96KN2
Sites not aligning to the query:
4op4B Crystal structure of the catalytic domain of dape protein from v.Cholerea in the zn bound form (see paper)
37% identity, 28% coverage: 65:175/390 of query aligns to 56:170/265 of 4op4B
Sites not aligning to the query:
1q7lA Zn-binding domain of the t347g mutant of human aminoacylase-i (see paper)
44% identity, 21% coverage: 71:150/390 of query aligns to 69:149/192 of 1q7lA
Sites not aligning to the query:
2pokA Crystal structure of a m20 family metallo peptidase from streptococcus pneumoniae
26% identity, 41% coverage: 71:231/390 of query aligns to 86:256/458 of 2pokA
Sites not aligning to the query:
4mmoA The crystal structure of a m20 family metallo-carboxypeptidase sso-cp2 from sulfolobus solfataricus
28% identity, 46% coverage: 49:229/390 of query aligns to 42:232/437 of 4mmoA
>WP_050460811.1 NCBI__GCF_001189915.1:WP_050460811.1
MNTRQWLEKLVSFDTTSRNSNLELIETVRDALQAQGVTPWFDHNKDRSKANLFATLPATH
GPQAGSEQGGIVLSGHTDVVPVDGQNWDTDPFVLTEKDGLLYARGSCDMKGYIAASMALV
PEFLAMPRLRPIHLAFSYDEEIGCVGAPGMLTELQARGVRPDGCVVGEPTNMQVVVAHKG
INVFNCRVHGRSAHSSLTPQGCNAIEYAARLICTIRDFADAMKAEGPYDTLYDVPFSTMT
TNQIRGGIAVNTIPDLCEFTYEFRNLPGMSPEKIQSRIQEYVRDQLLPKMQAEFPDARID
IGSIAGSPALETAEQEAITALVRALTGDTAQRKVAYATEAGLFQRIGIPTIVCGPGDIIQ
AHKPNEFVAVAQLQRCEDFLRKLGRSLQEA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory