Comparing WP_050463180.1 NCBI__GCF_001189915.1:WP_050463180.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
6sulA Amicoumacin kinase amin in complex with amp-pnp, mg2+ and ami (see paper)
23% identity, 60% coverage: 35:226/318 of query aligns to 36:234/334 of 6sulA
Sites not aligning to the query:
6sunA Amicoumacin kinase hamin in complex with amp-pnp, ca2+ and ami (see paper)
21% identity, 51% coverage: 65:226/318 of query aligns to 69:235/334 of 6sunA
Sites not aligning to the query:
6sumA Amicoumacin kinase hamin in complex with amp-pnp, mg2+ and ami (see paper)
21% identity, 51% coverage: 65:226/318 of query aligns to 69:235/335 of 6sumA
Sites not aligning to the query:
>WP_050463180.1 NCBI__GCF_001189915.1:WP_050463180.1
MAVFTPVSLDDLSGWLTQFSLGKAQAIKGISSGIENSNFFITTDSGEYVLTLFEKLTFEQ
LPFYLELMRHLAQRGVLVPAPVANQQGSIINALNGKPASIVTKLEGESQLSPTPVHCAEV
GAMLAHMHLAAQDFTIRQPNLRGLSWWRETTPVVLPYLPADTQDLLRTEMQFQETFAASA
TYAQLPNGPVHADLFRNNAMFVDTRLTGFFDFYFAGCDTWLFDLAVTVNDWCIDVDSGAL
DFPRAQAMMDAYHAVRPFSAAEQQAWQPMLRAAALRFWISRLYDFYLPRDAEMLTPHDPG
HFERILRLRITHPVPALN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory