SitesBLAST
Comparing WP_050465872.1 NCBI__GCF_001189915.1:WP_050465872.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
1nvmB Crystal structure of a bifunctional aldolase-dehydrogenase : sequestering a reactive and volatile intermediate (see paper)
73% identity, 98% coverage: 3:311/314 of query aligns to 2:312/312 of 1nvmB
- binding nicotinamide-adenine-dinucleotide: I10 (= I11), G11 (= G12), S12 (= S13), G13 (= G14), N14 (= N15), I15 (= I16), G37 (= G38), I38 (= I39), A78 (= A79), T79 (= T80), L103 (= L102), T104 (= T103), C132 (= C131), G165 (= G164), P166 (= P165), G167 (= G166), T168 (= T167), N171 (= N170), N290 (= N289), L291 (= L290), M294 (= M293)
Q52060 Acetaldehyde dehydrogenase; Acetaldehyde dehydrogenase [acetylating]; EC 1.2.1.10 from Pseudomonas sp. (strain CF600) (see paper)
73% identity, 98% coverage: 3:311/314 of query aligns to 2:312/312 of Q52060
- SGNI 12:15 (= SGNI 13:16) binding NAD(+)
- 163:171 (vs. 162:170, 100% identical) binding NAD(+)
- N290 (= N289) binding NAD(+)
P9WQH3 Propanal dehydrogenase (CoA-propanoylating); Acetaldehyde dehydrogenase; Acetaldehyde dehydrogenase [acetylating]; EC 1.2.1.87; EC 1.2.1.10 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
55% identity, 97% coverage: 4:309/314 of query aligns to 3:297/303 of P9WQH3
- S41 (= S43) mutation to D: 2200-fold decrease in catalytic efficiency with coenzyme A.; mutation to I: 6600-fold decrease in catalytic efficiency with coenzyme A.
4lrsB Crystal and solution structures of the bifunctional enzyme (aldolase/aldehyde dehydrogenase) from thermomonospora curvata, reveal a cofactor-binding domain motion during NAD+ and coa accommodation whithin the shared cofactor-binding site
55% identity, 96% coverage: 5:306/314 of query aligns to 2:292/294 of 4lrsB
- binding nicotinamide-adenine-dinucleotide: G9 (= G12), P10 (≠ S13), G11 (= G14), N12 (= N15), I13 (= I16), V35 (≠ I39), A73 (= A79), T74 (= T80), L96 (= L102), T97 (= T103), C125 (= C131), G158 (= G164), P159 (= P165), G160 (= G166), T161 (= T167), N164 (= N170), N275 (= N289), L276 (= L290), M279 (= M293)
4lrtB Crystal and solution structures of the bifunctional enzyme (aldolase/aldehyde dehydrogenase) from thermomonospora curvata, reveal a cofactor-binding domain motion during NAD+ and coa accommodation whithin the shared cofactor-binding site
55% identity, 96% coverage: 5:306/314 of query aligns to 4:294/295 of 4lrtB
- binding coenzyme a: G11 (= G12), P12 (≠ S13), G13 (= G14), N14 (= N15), I15 (= I16), G36 (= G38), V37 (≠ I39), S41 (= S43), A75 (= A79), T76 (= T80), C127 (= C131), T163 (= T167), N277 (= N289), L278 (= L290)
Q79AF6 Acetaldehyde dehydrogenase 4; Acetaldehyde dehydrogenase [acetylating] 4; Propanal dehydrogenase (CoA-propanoylating); EC 1.2.1.10; EC 1.2.1.87 from Paraburkholderia xenovorans (strain LB400) (see 2 papers)
54% identity, 98% coverage: 3:310/314 of query aligns to 2:294/304 of Q79AF6
- C131 (= C131) active site, Acyl-thioester intermediate; mutation C->A,S: Loss of catalytic activity. Still able to bind NAD(+), however with much lower affinity.
- N170 (= N170) mutation N->A,D: Displays significant reduction in the level of allosteric activation of the aldol cleavage reaction by BphI.
- I171 (= I171) mutation I->A,F: Exhibits preferences for aldehydes similar as wild-type. Exhibits about 80% of wild-type acetaldehyde channeling efficiency. Displays significant reduction in the level of allosteric activation of the aldol cleavage reaction by BphI.
- I195 (= I195) mutation to A: 5-fold decrease in affinity for acetaldehyde. Increase in affinity for butyraldehyde and pentaldehyde, leading to a 9- and 20-fold increase in catalytic efficiency with butyraldehyde and pentaldehyde as substrate, respectively. Exhibits 84% of wild-type acetaldehyde channeling efficiency.; mutation to F: 4- to 7-fold decrease in catalytic efficiency with aldehydes three to four carbons in length. Does not significantly reduce the channeling efficiency of the enzyme complex toward acetaldehyde or propanaldehyde.; mutation to L: Does not significantly reduce the channeling efficiency of the enzyme complex toward acetaldehyde or propanaldehyde.; mutation to W: 5- to 16-fold decrease in catalytic efficiency with aldehydes two to four carbons in length. Exhibits 59% of wild-type acetaldehyde channeling efficiency.
- D208 (= D208) mutation to A: 2-fold decrease in catalytic efficiency.
Query Sequence
>WP_050465872.1 NCBI__GCF_001189915.1:WP_050465872.1
MSNNKVKVAIIGSGNIGTDLMIKVLRNAKHLEMGAFVGIDPASDGLERARRLNVPVTAEG
IDGLLKMPEFADIRIAFDATSAGAHAHHNALLQQHGVRVIDLTPAAIGPYVIPAINLDEQ
LGASNINMVTCGGQATIPVVAAISRVTKVHYAEIVASISSKSAGPGTRANIDEFTETTSR
AIEVLGGATRGKAIIVLNPADPPLIMRDTVFALADPADQQAIEDSILKMVEQVNSYVPGY
RIKQKVQFDLFDEANALNIPGIGKKSGLKVSVFLEVEGAAHYLPAYAGNLDIMTSAALAC
ADRMAQTQLAAVAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory