SitesBLAST
Comparing WP_050750700.1 NCBI__GCF_000009985.1:WP_050750700.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6z1mA Structure of an ancestral glycosidase (family 1) bound to heme (see paper)
45% identity, 97% coverage: 14:447/449 of query aligns to 6:421/423 of 6z1mA
- binding protoporphyrin ix containing fe: P164 (≠ F172), N165 (≠ S173), L194 (≠ V202), L195 (≠ N203), L218 (≠ H226), L220 (≠ R228), N244 (= N252), F247 (= F255), K253 (≠ L261), Y256 (= Y264), L288 (≠ T288), R318 (≠ T340), Y323 (= Y345)
- binding magnesium ion: H346 (≠ D372), K409 (≠ N435)
6m6lB The crystal structure of glycosidase hydrolyzing notoginsenoside
46% identity, 99% coverage: 7:449/449 of query aligns to 2:445/445 of 6m6lB
6rjmB Complex structure of virulence factor sgha and its hydrolysis product glucose (see paper)
45% identity, 97% coverage: 14:449/449 of query aligns to 13:450/456 of 6rjmB
- binding alpha-D-glucopyranose: Q24 (= Q25), H125 (= H126), N169 (= N170), E170 (= E171), Y298 (= Y296), W331 (= W327), E358 (= E353), W404 (= W403), E411 (= E410), W412 (= W411), F420 (= F419)
6rk2A Complex structure of virulence factor sgha mutant with its substrate sag (see paper)
45% identity, 97% coverage: 14:449/449 of query aligns to 17:454/454 of 6rk2A
6rjoA Complex structure of virulence factor sgha with its substrate analog salicin (see paper)
45% identity, 97% coverage: 14:449/449 of query aligns to 17:454/454 of 6rjoA
P12614 Beta-glucosidase; Amygdalase; Beta-D-glucoside glucohydrolase; Cellobiase; Gentiobiase; EC 3.2.1.21 from Agrobacterium sp. (strain ATCC 21400)
45% identity, 97% coverage: 14:449/449 of query aligns to 14:451/459 of P12614
- E359 (= E353) active site, Nucleophile
1oinA Family 1 b-glucosidase from thermotoga maritima (see paper)
42% identity, 98% coverage: 7:447/449 of query aligns to 1:439/442 of 1oinA
- active site: R76 (= R82), H120 (= H126), E165 (= E171), V168 (= V174), N292 (= N294), Y294 (= Y296), E348 (= E353)
- binding 2-deoxy-2-fluoro-alpha-D-glucopyranose: Q19 (= Q25), H120 (= H126), N164 (= N170), E165 (= E171), Y294 (= Y296), E348 (= E353), W395 (= W403), E402 (= E410), W403 (= W411)
2wc3A Structure of family 1 beta-glucosidase from thermotoga maritima in complex with 3-imino-2-oxa-(+)-8-epi-castanospermine (see paper)
42% identity, 98% coverage: 7:447/449 of query aligns to 1:439/442 of 2wc3A
- active site: R76 (= R82), H120 (= H126), E165 (= E171), V168 (= V174), N292 (= N294), Y294 (= Y296), E348 (= E353)
- binding (3Z,5S,6R,7S,8S,8aR)-3-(octylimino)hexahydro[1,3]oxazolo[3,4-a]pyridine-5,6,7,8-tetrol: Q19 (= Q25), H120 (= H126), N164 (= N170), E165 (= E171), Y294 (= Y296), H297 (≠ I299), W321 (= W327), E348 (= E353), W395 (= W403), E402 (= E410), W403 (= W411), F411 (= F419)
8ivyA Beta-glucosidase bgla mutant e166q in complex with glucose (see paper)
40% identity, 97% coverage: 14:447/449 of query aligns to 9:446/451 of 8ivyA
2cesA Beta-glucosidase from thermotoga maritima in complex with glucoimidazole (see paper)
43% identity, 96% coverage: 15:447/449 of query aligns to 8:437/440 of 2cesA
- active site: R75 (= R82), H119 (= H126), E164 (= E171), V167 (= V174), N291 (= N294), Y293 (= Y296), E346 (= E353)
- binding glucoimidazole: Q18 (= Q25), H119 (= H126), N163 (= N170), E164 (= E171), Y293 (= Y296), E346 (= E353), W393 (= W403), E400 (= E410), W401 (= W411), F409 (= F419)
4ptwA Halothermothrix orenii beta-glucosidase a, 2-deoxy-2-fluoro-glucose complex (see paper)
42% identity, 97% coverage: 14:447/449 of query aligns to 6:444/445 of 4ptwA
- active site: R74 (= R82), H118 (= H126), E163 (= E171), V166 (= V174), N291 (= N294), Y293 (= Y296), E351 (= E353)
- binding 2-deoxy-2-fluoro-alpha-D-glucopyranose: Q17 (= Q25), H118 (= H126), E163 (= E171), Y293 (= Y296), E351 (= E353), W398 (= W403), E405 (= E410), W406 (= W411)
4ptvA Halothermothrix orenii beta-glucosidase a, thiocellobiose complex (see paper)
42% identity, 97% coverage: 14:447/449 of query aligns to 6:444/445 of 4ptvA
- active site: R74 (= R82), H118 (= H126), E163 (= E171), V166 (= V174), N291 (= N294), Y293 (= Y296), E351 (= E353)
- binding beta-D-glucopyranose: W324 (= W327), E405 (= E410), Y408 (≠ S413)
- binding 4-thio-beta-D-glucopyranose: Q17 (= Q25), H118 (= H126), E163 (= E171), Y293 (= Y296), E351 (= E353), W398 (= W403), E405 (= E410), W406 (= W411)
2j78A Beta-glucosidase from thermotoga maritima in complex with gluco- hydroximolactam (see paper)
43% identity, 96% coverage: 15:447/449 of query aligns to 8:439/443 of 2j78A
- active site: R75 (= R82), H119 (= H126), E164 (= E171), V167 (= V174), N291 (= N294), Y293 (= Y296), E348 (= E353)
- binding calcium ion: E64 (≠ G71), E67 (≠ K74), D276 (≠ G279), S279 (≠ A282)
- binding (2s,3s,4r,5r)-6-(hydroxyamino)-2-(hydroxymethyl)-2,3,4,5-tetrahydropyridine-3,4,5-triol: Q18 (= Q25), H119 (= H126), N163 (= N170), E164 (= E171), Y293 (= Y296), E348 (= E353), W395 (= W403), E402 (= E410), W403 (= W411), F411 (= F419)
1uz1A Family 1 b-glucosidase from thermotoga maritima in complex with isofagomine lactam (see paper)
43% identity, 96% coverage: 15:447/449 of query aligns to 8:436/439 of 1uz1A
- active site: R75 (= R82), H119 (= H126), E164 (= E171), V167 (= V174), N290 (= N294), Y292 (= Y296), E345 (= E353)
- binding (3s,4r,5r)-3,4-dihydroxy-5-(hydroxymethyl)piperidin-2-one: Q18 (= Q25), H119 (= H126), N163 (= N170), E164 (= E171), Y292 (= Y296), E345 (= E353), W392 (= W403), E399 (= E410), W400 (= W411), F408 (= F419)
2jalB Beta-glucosidase from thermotoga maritima in complex with cyclophellitol (see paper)
42% identity, 98% coverage: 7:447/449 of query aligns to 1:441/444 of 2jalB
- active site: R76 (= R82), H120 (= H126), E165 (= E171), V168 (= V174), N292 (= N294), Y294 (= Y296), E350 (= E353)
- binding calcium ion: D277 (≠ G279), E281 (≠ R283)
- binding (1r,2s,3s,4s,5r,6r)-6-(hydroxymethyl)cyclohexane-1,2,3,4,5-pentol: Q19 (= Q25), H120 (= H126), E165 (= E171), E350 (= E353), W397 (= W403), E404 (= E410), W405 (= W411), F413 (= F419)
2vrjA Beta-glucosidase from thermotoga maritima in complex with n-octyl-5- deoxy-6-oxa-n-(thio)carbamoylcalystegine (see paper)
43% identity, 96% coverage: 15:447/449 of query aligns to 8:435/438 of 2vrjA
- active site: R75 (= R82), H119 (= H126), E164 (= E171), V167 (= V174), N288 (= N294), Y290 (= Y296), E344 (= E353)
- binding calcium ion: H38 (≠ R45), D50 (= D57)
- binding (1S,2R,3S,4R,5R)-2,3,4-trihydroxy-N-octyl-6-oxa-8-azabicyclo[3.2.1]octane-8-carbothioamide: Q18 (= Q25), H119 (= H126), E164 (= E171), H178 (≠ A185), Y290 (= Y296), E344 (= E353), W391 (= W403), E398 (= E410), W399 (= W411), A400 (≠ G412), E401 (≠ S413)
2j7dA Beta-glucosidase from thermotoga maritima in complex with methoxycarbonyl-substituted glucoimidazole (see paper)
43% identity, 96% coverage: 15:447/449 of query aligns to 8:434/437 of 2j7dA
- active site: R75 (= R82), H119 (= H126), E164 (= E171), V167 (= V174), N287 (= N294), Y289 (= Y296), E343 (= E353)
- binding methoxycarbonyl-substituted glucoimidazole: Q18 (= Q25), H119 (= H126), E164 (= E171), N220 (= N227), Y289 (= Y296), W316 (= W327), E343 (= E353), W390 (= W403), E397 (= E410), W398 (= W411), F406 (= F419)
2j7cA Beta-glucosidase from thermotoga maritima in complex with phenylaminomethyl-derived glucoimidazole (see paper)
43% identity, 96% coverage: 15:447/449 of query aligns to 8:434/437 of 2j7cA
- active site: R75 (= R82), H119 (= H126), E164 (= E171), V167 (= V174), N287 (= N294), Y289 (= Y296), E343 (= E353)
- binding (5r,6r,7s,8s)-3-(anilinomethyl)-5,6,7,8-tetrahydro-5-(hydroxymethyl)-imidazo[1,2-a]pyridine-6,7,8-triol: Q18 (= Q25), H119 (= H126), E164 (= E171), Y289 (= Y296), W316 (= W327), E343 (= E353), W390 (= W403), E397 (= E410), W398 (= W411), F406 (= F419)
2j7bA Beta-glucosidase from thermotoga maritima in complex with gluco- tetrazole (see paper)
43% identity, 96% coverage: 15:447/449 of query aligns to 8:434/437 of 2j7bA
- active site: R75 (= R82), H119 (= H126), E164 (= E171), V167 (= V174), N287 (= N294), Y289 (= Y296), E343 (= E353)
- binding nojirimycine tetrazole: Q18 (= Q25), H119 (= H126), N163 (= N170), E164 (= E171), Y289 (= Y296), E343 (= E353), W390 (= W403), E397 (= E410), W398 (= W411), F406 (= F419)
2cbuA Beta-glucosidase from thermotoga maritima in complex with castanospermine (see paper)
43% identity, 96% coverage: 15:447/449 of query aligns to 8:436/440 of 2cbuA
- active site: R75 (= R82), H119 (= H126), E164 (= E171), V167 (= V174), N289 (= N294), Y291 (= Y296), E345 (= E353)
- binding castanospermine: Q18 (= Q25), H119 (= H126), N163 (= N170), E164 (= E171), Y291 (= Y296), W318 (= W327), E345 (= E353), W392 (= W403), E399 (= E410), W400 (= W411), F408 (= F419)
Query Sequence
>WP_050750700.1 NCBI__GCF_000009985.1:WP_050750700.1
MGAGNKNITSLRPDFVWGVSTSAFQVEGATKEDGRGLSIWDTRCRLQGGVWTGANADVAC
DHYHRWPEDVGLIKDLGVDAYRFSIAWPRLLPKGKGPVNQKGLDFYDRLIDGVLEAGITP
WVCLYHWDLPQALDDLGGWTNRDCAGWFADYAVLAAKRYGDRVKHFATFNEFSVFTMFGY
AIDWAAPGVTDRAAHMKAIHHVNLAHGMGVDVLRDHVKDVSIGAIHNRQIVRPEGGLAEN
QAAADLLDAHWNGVFCDPQHLGHYPEIMARDVEPYVQAGDLARICRPTDWMGLNHYGPIY
AKADPATTWGYGWGAPPESANHPEVGWPIFPEVFKDELLTLTRRYGLPVYVTENGCGGGA
GSDTPDENGVVDDTHRLAYFREYQQAMLDAVAEGADVRGYFVWALLDNFEWGSGYGPRFG
LYHVDFDSQKRTLKNSGKWYRDMIKGQRK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory