SitesBLAST
Comparing WP_050750753.1 NCBI__GCF_000009985.1:WP_050750753.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5xfaA Crystal structure of NAD+-reducing [nife]-hydrogenase in the h2- reduced state (see paper)
44% identity, 92% coverage: 32:600/619 of query aligns to 7:572/581 of 5xfaA
5xf9A Crystal structure of NAD+-reducing [nife]-hydrogenase in the air- oxidized state (see paper)
44% identity, 90% coverage: 32:590/619 of query aligns to 11:566/576 of 5xf9A
- binding flavin mononucleotide: G197 (= G215), G199 (= G217), K208 (= K226), N225 (= N247), D227 (= D249), Y309 (= Y336), G312 (= G339), E313 (= E340), E314 (= E341), N348 (= N375), N349 (= N376), F522 (≠ L546)
- binding iron/sulfur cluster: P328 (= P355), S473 (= S497), C474 (= C498), G475 (= G499), F476 (= F500), C477 (= C501), C480 (= C504), N519 (≠ H543), C520 (= C544), F522 (≠ L546)
Sites not aligning to the query:
7q4vB Electron bifurcating hydrogenase - hydabc from a. Woodii (see paper)
38% identity, 75% coverage: 108:573/619 of query aligns to 28:530/599 of 7q4vB
- binding fe2/s2 (inorganic) cluster: C48 (= C126), F49 (≠ T127), L51 (= L129), C52 (= C130)
- binding flavin mononucleotide: G166 (= G215), G168 (= G217), N196 (= N247), D198 (= D249), F284 (≠ Y336), G287 (= G339), E288 (= E340), E289 (= E341), N324 (= N376)
- binding iron/sulfur cluster: C457 (= C498), G458 (= G499), K459 (≠ F500), C460 (= C501), C463 (= C504), C503 (= C544), G506 (= G547)
- binding zinc ion: C440 (≠ D481), H527 (≠ N570)
Sites not aligning to the query:
- binding fe2/s2 (inorganic) cluster: 11, 16
- binding iron/sulfur cluster: 544, 551, 552, 553, 554, 555, 556, 557, 561, 562, 574, 581, 583, 584, 585, 586, 587, 591, 593, 595
- binding zinc ion: 533
4hea1 Crystal structure of the entire respiratory complex i from thermus thermophilus (see paper)
41% identity, 59% coverage: 199:565/619 of query aligns to 47:420/437 of 4hea1
- binding flavin mononucleotide: G63 (= G215), K74 (= K226), N91 (= N247), D93 (= D249), Y179 (= Y336), G182 (= G339), E183 (= E340), N218 (= N375), N219 (= N376), L401 (= L546)
- binding iron/sulfur cluster: I180 (≠ V337), P198 (= P355), S351 (= S497), C352 (= C498), G353 (= G499), K354 (≠ F500), C355 (= C501), C358 (= C504), F398 (≠ H543), C399 (= C544), L401 (= L546)
2ybb1 Fitted model for bovine mitochondrial supercomplex i1iii2iv1 by single particle cryo-em (emd-1876) (see paper)
41% identity, 59% coverage: 199:565/619 of query aligns to 47:420/437 of 2ybb1
- binding flavin mononucleotide: G63 (= G215), G65 (= G217), N91 (= N247), D93 (= D249), G182 (= G339), E183 (= E340), E184 (= E341), N218 (= N375), N219 (= N376), T222 (= T379), P400 (≠ G545)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G65 (= G217), G66 (= G218), F69 (= F221), K74 (= K226), F77 (= F229), E96 (= E252), Y179 (= Y336), E184 (= E341), K201 (≠ R358), F204 (= F361), T324 (vs. gap)
- binding iron/sulfur cluster: S351 (= S497), C352 (= C498), K354 (≠ F500), C355 (= C501), C358 (= C504), F398 (≠ H543), C399 (= C544), L401 (= L546), A402 (≠ G547)
Q56222 NADH-quinone oxidoreductase subunit 1; NADH dehydrogenase I chain 1; NDH-1 subunit 1; EC 7.1.1.- from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
41% identity, 59% coverage: 199:565/619 of query aligns to 48:421/438 of Q56222
6saqB Wild-type nuoef from aquifex aeolicus bound to nadh-oh (see paper)
43% identity, 60% coverage: 196:566/619 of query aligns to 44:414/419 of 6saqB
- binding flavin mononucleotide: G64 (= G215), G66 (= G217), K75 (= K226), N91 (= N247), D93 (= D249), E94 (= E250), Y179 (= Y336), G182 (= G339), E183 (= E340), N218 (= N375), N219 (= N376), T222 (= T379)
- binding [[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] [(2~{R},3~{S},4~{R},5~{R})-5-[[(1~{E},3~{Z})-5-azanyl-4-oxidanyl-5-oxidanylidene-penta-1,3-dienyl]-methanoyl-amino]-3,4-bis(oxidanyl)oxolan-2-yl]methyl hydrogen phosphate: G66 (= G217), G67 (= G218), A68 (= A219), F70 (= F221), K75 (= K226), E94 (= E250), E96 (= E252), T99 (= T255), E184 (= E341), Y204 (≠ F361), T318 (vs. gap)
- binding iron/sulfur cluster: P198 (= P355), T345 (≠ S497), C346 (= C498), G347 (= G499), Q348 (≠ F500), C349 (= C501), C352 (= C504), I391 (≠ H543), C392 (= C544), G395 (= G547)
6q9cB Crystal structure of aquifex aeolicus nadh-quinone oxidoreductase subunits nuoe and nuof bound to nadh under anaerobic conditions (see paper)
43% identity, 60% coverage: 196:566/619 of query aligns to 44:414/418 of 6q9cB
- binding flavin mononucleotide: G64 (= G215), G66 (= G217), K75 (= K226), N91 (= N247), D93 (= D249), E94 (= E250), G182 (= G339), E183 (= E340), E184 (= E341), V217 (= V374), N218 (= N375), N219 (= N376), T222 (= T379), G393 (= G545)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G66 (= G217), G67 (= G218), A68 (= A219), F70 (= F221), K75 (= K226), E94 (= E250), E96 (= E252), Y179 (= Y336), E184 (= E341), Y204 (≠ F361)
- binding iron/sulfur cluster: P198 (= P355), T345 (≠ S497), C346 (= C498), G347 (= G499), Q348 (≠ F500), C349 (= C501), C352 (= C504), I391 (≠ H543), C392 (= C544), L394 (= L546), G395 (= G547)
6hl3B Wild-type nuoef from aquifex aeolicus - oxidized form bound to NAD+ (see paper)
43% identity, 60% coverage: 196:566/619 of query aligns to 43:413/416 of 6hl3B
- binding flavin mononucleotide: G63 (= G215), G65 (= G217), K74 (= K226), N90 (= N247), D92 (= D249), E93 (= E250), G181 (= G339), E182 (= E340), E183 (= E341), V216 (= V374), N217 (= N375), N218 (= N376), T221 (= T379)
- binding nicotinamide-adenine-dinucleotide: G65 (= G217), G66 (= G218), A67 (= A219), F69 (= F221), K74 (= K226), E95 (= E252), Y178 (= Y336), E183 (= E341), K200 (≠ R358), Y203 (≠ F361)
- binding iron/sulfur cluster: I179 (≠ V337), P197 (= P355), T344 (≠ S497), C345 (= C498), G346 (= G499), Q347 (≠ F500), C348 (= C501), C351 (= C504), S389 (= S542), I390 (≠ H543), C391 (= C544), L393 (= L546), G394 (= G547)
7q5yC Structure of nadh:ubichinon oxidoreductase (complex i) of the hyperthermophilic eubacterium aquifex aeolicus
43% identity, 60% coverage: 196:566/619 of query aligns to 45:415/419 of 7q5yC
- binding flavin mononucleotide: G65 (= G215), G67 (= G217), K76 (= K226), N92 (= N247), E95 (= E250), Y180 (= Y336), G183 (= G339), E184 (= E340), V218 (= V374), N219 (= N375), N220 (= N376), T223 (= T379)
- binding iron/sulfur cluster: T346 (≠ S497), C347 (= C498), G348 (= G499), Q349 (≠ F500), C350 (= C501), C353 (= C504), S391 (= S542), I392 (≠ H543), C393 (= C544), G396 (= G547)
7p8nB Tmhydabc- t. Maritima hydrogenase with bridge closed (see paper)
39% identity, 72% coverage: 119:565/619 of query aligns to 60:541/613 of 7p8nB
- binding fe2/s2 (inorganic) cluster: C67 (= C126), C68 (≠ T127), G69 (= G128), R70 (≠ L129), C71 (= C130)
- binding flavin mononucleotide: G185 (= G215), R186 (= R216), G187 (= G217), N213 (= N247), D215 (= D249), E216 (= E250), G217 (= G251), F301 (≠ Y336), G304 (= G339), E305 (= E340), E306 (= E341), N340 (= N375), N341 (= N376), G521 (= G545), L522 (= L546)
- binding iron/sulfur cluster: P320 (= P355), S473 (= S497), C474 (= C498), G475 (= G499), K476 (≠ F500), C477 (= C501), C480 (= C504), L519 (≠ H543), C520 (= C544), L522 (= L546), G523 (= G547)
- binding zinc ion: C457 (≠ D481)
Sites not aligning to the query:
- binding fe2/s2 (inorganic) cluster: 31, 33, 34, 36
- binding iron/sulfur cluster: 560, 567, 570, 571, 573, 577, 590, 592, 597, 599, 600, 601, 603, 607
- binding zinc ion: 544, 549, 554
8a6tB Cryo-em structure of the electron bifurcating fe-fe hydrogenase hydabc complex from thermoanaerobacter kivui in the reduced state (see paper)
36% identity, 74% coverage: 119:573/619 of query aligns to 75:561/630 of 8a6tB
- binding fe2/s2 (inorganic) cluster: C82 (= C126), F85 (≠ L129), C86 (= C130)
- binding flavin mononucleotide: G201 (= G217), N227 (= N247), E230 (= E250), N355 (= N376), G535 (= G545), L536 (= L546)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S320 (≠ E341), R337 (= R358), R340 (≠ F361), T341 (≠ P362), N342 (≠ V363), S433 (= S449)
- binding iron/sulfur cluster: S487 (= S497), C488 (= C498), G489 (= G499), C491 (= C501), C494 (= C504), C534 (= C544), L536 (= L546), G537 (= G547)
- binding zinc ion: C471 (≠ D481), H558 (≠ N570)
Sites not aligning to the query:
- binding fe2/s2 (inorganic) cluster: 31, 33, 36
- binding iron/sulfur cluster: 575, 577, 582, 583, 585, 588, 592, 596, 597, 607, 612, 618, 622, 624, 626, 627
- binding zinc ion: 564
7q4vF Electron bifurcating hydrogenase - hydabc from a. Woodii (see paper)
42% identity, 60% coverage: 200:569/619 of query aligns to 22:399/470 of 7q4vF
- binding flavin mononucleotide: G37 (= G215), G39 (= G217), N67 (= N247), G158 (= G339), E159 (= E340), E160 (= E341), G375 (= G545)
- binding nicotinamide-adenine-dinucleotide: G40 (= G218), F43 (= F221), K48 (= K226), R177 (= R358), F180 (= F361), M297 (≠ F473)
- binding iron/sulfur cluster: S327 (= S497), C328 (= C498), G329 (= G499), K330 (≠ F500), C331 (= C501), C334 (= C504), L373 (≠ H543), C374 (= C544)
- binding zinc ion: C311 (≠ D481), H398 (≠ R568)
Sites not aligning to the query:
- binding iron/sulfur cluster: 415, 417, 422, 424, 425, 426, 427, 428, 432, 433, 437, 445, 452, 454, 455, 456, 457, 458, 462, 463, 467
- binding zinc ion: 404, 409
7t30B Structure of electron bifurcating ni-fe hydrogenase complex hydabcsl in fmn/NAD(h) bound state (see paper)
42% identity, 63% coverage: 173:565/619 of query aligns to 18:410/425 of 7t30B
- binding fe2/s2 (inorganic) cluster: C326 (≠ D481), C364 (≠ D519)
- binding flavin mononucleotide: G54 (= G215), G56 (= G217), K65 (= K226), N82 (= N247), D84 (= D249), E85 (= E250), G173 (= G339), E175 (= E341), N210 (= N376), G390 (= G545), L391 (= L546)
- binding nicotinamide-adenine-dinucleotide: G56 (= G217), G57 (= G218), A58 (= A219), F60 (= F221), K65 (= K226), F68 (= F229), E85 (= E250), E175 (= E341), R192 (= R358), F195 (= F361), I312 (≠ F473), M313 (= M474), S315 (vs. gap)
- binding iron/sulfur cluster: S342 (= S497), C343 (= C498), G344 (= G499), C346 (= C501), C349 (= C504), S387 (= S542), C389 (= C544), L391 (= L546), G392 (= G547)
Sites not aligning to the query:
7t2rB Structure of electron bifurcating ni-fe hydrogenase complex hydabcsl in fmn-free apo state (see paper)
42% identity, 63% coverage: 173:565/619 of query aligns to 18:410/425 of 7t2rB
Sites not aligning to the query:
7p61F Complex i from e. Coli, ddm-purified, with nadh, resting state (see paper)
40% identity, 63% coverage: 176:566/619 of query aligns to 27:420/442 of 7p61F
- binding flavin mononucleotide: G61 (= G215), G63 (= G217), K72 (= K226), N90 (= N247), D92 (= D249), G181 (= G339), E182 (= E340), N217 (= N375), N218 (= N376), A399 (≠ G545), H400 (≠ L546)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G63 (= G217), G64 (= G218), A65 (= A219), F67 (= F221), K72 (= K226), L75 (≠ F229), E95 (= E252), Y178 (= Y336), E183 (= E341), F203 (= F361), R320 (vs. gap), T323 (vs. gap)
- binding iron/sulfur cluster: S350 (= S497), C351 (= C498), W353 (≠ F500), C354 (= C501), C357 (= C504), F397 (≠ H543), C398 (= C544), H400 (≠ L546)
8a5eB Cryo-em structure of the electron bifurcating fe-fe hydrogenase hydabc complex from acetobacterium woodii in the reduced state (see paper)
42% identity, 59% coverage: 203:569/619 of query aligns to 2:376/447 of 8a5eB
- binding flavin mononucleotide: G14 (= G215), G16 (= G217), N44 (= N247), G135 (= G339), E137 (= E341), N171 (= N375), N172 (= N376), G352 (= G545)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G16 (= G217), G17 (= G218), F20 (= F221), K25 (= K226), F28 (= F229), D49 (≠ E252), R154 (= R358), F157 (= F361), S250 (= S449)
- binding iron/sulfur cluster: P151 (= P355), C305 (= C498), G306 (= G499), K307 (≠ F500), C308 (= C501), C311 (= C504), C351 (= C544), G354 (= G547)
- binding zinc ion: C288 (≠ D481), H375 (≠ R568)
Sites not aligning to the query:
- binding iron/sulfur cluster: 392, 399, 401, 402, 403, 405, 409, 410, 414, 429, 431, 432, 433, 435, 439, 440, 444
- binding zinc ion: 381, 386
8oh5B Cryo-em structure of the electron bifurcating transhydrogenase stnabc complex from sporomusa ovata (state 2) (see paper)
42% identity, 61% coverage: 196:573/619 of query aligns to 132:515/584 of 8oh5B
- binding flavin mononucleotide: R154 (= R216), K164 (= K226), N181 (= N247), F269 (≠ Y336), E273 (= E340), E274 (= E341), I307 (≠ V374), N308 (= N375), N309 (= N376), G489 (= G545), L490 (= L546)
- binding nicotinamide-adenine-dinucleotide: G155 (= G217), G156 (= G218), F159 (= F221), F163 (≠ Q225), E273 (= E340), E274 (= E341), K291 (≠ R358), F294 (= F361), G413 (vs. gap)
- binding iron/sulfur cluster: P288 (= P355), C442 (= C498), G443 (= G499), C445 (= C501), C448 (= C504), C488 (= C544), L490 (= L546), G491 (= G547)
- binding zinc ion: C425 (≠ D481), H512 (≠ N570)
Sites not aligning to the query:
- binding fe2/s2 (inorganic) cluster: 10, 41, 45
- binding iron/sulfur cluster: 531, 536, 540, 542, 546, 547, 548, 559, 566, 567, 568, 569, 572
- binding zinc ion: 518, 523
8e9hF Mycobacterial respiratory complex i, fully-inserted quinone (see paper)
41% identity, 60% coverage: 201:570/619 of query aligns to 39:422/436 of 8e9hF
- binding flavin mononucleotide: G53 (= G215), R54 (= R216), G55 (= G217), A57 (= A219), K64 (= K226), N90 (= N247), D92 (= D249), Y178 (= Y336), G181 (= G339), E182 (= E340), E183 (= E341), N217 (= N375), N218 (= N376), S221 (≠ T379), L398 (= L546)
- binding iron/sulfur cluster: P197 (= P355), S349 (= S497), C350 (= C498), G351 (= G499), K352 (≠ F500), C353 (= C501), C356 (= C504), S394 (= S542), F395 (≠ H543), C396 (= C544), L398 (= L546), G399 (= G547)
- binding zinc ion: C333 (≠ D481), E371 (≠ D519), H420 (≠ R568)
Sites not aligning to the query:
7o6yB Cryo-em structure of respiratory complex i under turnover (see paper)
37% identity, 60% coverage: 198:570/619 of query aligns to 40:424/457 of 7o6yB
- binding flavin mononucleotide: G57 (= G215), G59 (= G217), K68 (= K226), N89 (= N247), D91 (= D249), E92 (= E250), G180 (= G339), E181 (= E340), E182 (= E341), T216 (≠ N375), N217 (= N376)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G59 (= G217), G60 (= G218), F63 (= F221), K68 (= K226), E94 (= E252), Y177 (= Y336), E182 (= E341), F202 (= F361), T324 (vs. gap)
- binding iron/sulfur cluster: P196 (= P355), S351 (= S497), C352 (= C498), G353 (= G499), Q354 (≠ F500), C355 (= C501), C358 (= C504), T396 (≠ S542), C398 (= C544), L400 (= L546)
Query Sequence
>WP_050750753.1 NCBI__GCF_000009985.1:WP_050750753.1
MPKGNPNGSDAGTVVSAVLARHGADGTRLMQILREIQEETEWLSPDILTRVAEGTRLPRG
QVEGVAGFYHFFHTEPLGRYRVLWSDNITDRMAGNADLMARMCKKLWLKPGRVSEDGLVS
VDTTSCTGLCDQGPALLVNYRPITRMTAQRVDQIVELIRHKTPLAEWPAEFFKVEDNIRR
KDALLGADFAPGDALKALKSPQEVLDSVKESGLRGRGGAGFSTGQKWDFCRAAVGTGPHA
AHYVVCNADEGEPGTFKDRVLLASYAGLVFEGMTVSGYVIGARKGIVYLRGEYRYLLEPL
NAVLEKRRAAKLLGKSILGRTGFDFDIEVHLGAGAYVCGEETALLESLEGKRGVPRKRPP
FPVTAGYLGQPTAVNNVETLASAALIAAKGAAWYKSIGTPKSAGTKILSISGDCERPGIY
EYPYGVKVSQVLADCGARDTQACQIAGASGLCVAPNEFGRRIAFEDIPTGGSFMIFDNTR
DMFQVARNFAHFFVHESCGFCTPCRVGTTLLANAMDKIDEGHGGEYDINDIWRVIRTLKT
ASHCGLGQTAGNAVADTLQKFRPSYELRLNVRDFEPAFDLDKALSKMREVTGRDDPGAHF
HIAHRKSRAGLGTKAGDPS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory