Comparing WP_050750796.1 NCBI__GCF_000009985.1:WP_050750796.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2xf4A Crystal structure of salmonella enterica serovar typhimurium ycbl (see paper)
34% identity, 83% coverage: 23:203/218 of query aligns to 11:194/210 of 2xf4A
7l0bA Crystal structure of hydroxyacyl glutathione hydrolase (glob) from staphylococcus aureus, apoenzyme (see paper)
31% identity, 85% coverage: 26:211/218 of query aligns to 15:195/202 of 7l0bA
7ev5A Crystal structure of bleg-1 b3 metallo-beta-lactamase (see paper)
33% identity, 83% coverage: 22:203/218 of query aligns to 9:193/209 of 7ev5A
2zwrB Crystal structure of ttha1623 from thermus thermophilus hb8 (see paper)
33% identity, 85% coverage: 18:203/218 of query aligns to 6:186/207 of 2zwrB
2zziA Crystal structure of ttha1623 in a di-iron-bound form (see paper)
33% identity, 85% coverage: 18:203/218 of query aligns to 4:184/198 of 2zziA
4yslA Crystal structure of sdoa from pseudomonas putida in complex with glutathione (see paper)
32% identity, 80% coverage: 28:201/218 of query aligns to 22:212/294 of 4yslA
Sites not aligning to the query:
4yskA Crystal structure of apo-form sdoa from pseudomonas putida (see paper)
32% identity, 80% coverage: 28:201/218 of query aligns to 22:212/294 of 4yskA
6rz0A Crystal structure of escherichia coli glyoxalase ii
31% identity, 84% coverage: 18:201/218 of query aligns to 3:165/251 of 6rz0A
4efzA Crystal structure of a hypothetical metallo-beta-lactamase from burkholderia pseudomallei
31% identity, 66% coverage: 47:190/218 of query aligns to 51:206/295 of 4efzA
4ysbA Crystal structure of ethe1 from myxococcus xanthus (see paper)
29% identity, 80% coverage: 28:201/218 of query aligns to 16:170/225 of 4ysbA
Q9SID3 Hydroxyacylglutathione hydrolase 2, mitochondrial; Glyoxalase II; Glx II; EC 3.1.2.6 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
27% identity, 92% coverage: 1:201/218 of query aligns to 57:239/324 of Q9SID3
2q42A Ensemble refinement of the protein crystal structure of glyoxalase ii from arabidopsis thaliana gene at2g31350 (see paper)
28% identity, 88% coverage: 21:211/218 of query aligns to 7:177/254 of 2q42A
Q16775 Hydroxyacylglutathione hydrolase, mitochondrial; Glyoxalase II; Glx II; EC 3.1.2.6 from Homo sapiens (Human) (see paper)
28% identity, 89% coverage: 8:201/218 of query aligns to 45:221/308 of Q16775
Sites not aligning to the query:
O24496 Hydroxyacylglutathione hydrolase cytoplasmic; Glyoxalase II; Glx II; EC 3.1.2.6 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
26% identity, 83% coverage: 28:208/218 of query aligns to 15:179/258 of O24496
Sites not aligning to the query:
1qh5B Human glyoxalase ii with s-(n-hydroxy-n-bromophenylcarbamoyl) glutathione (see paper)
27% identity, 80% coverage: 28:201/218 of query aligns to 15:173/260 of 1qh5B
Sites not aligning to the query:
1qh5A Human glyoxalase ii with s-(n-hydroxy-n-bromophenylcarbamoyl) glutathione (see paper)
27% identity, 80% coverage: 28:201/218 of query aligns to 15:173/260 of 1qh5A
Sites not aligning to the query:
1qh3A Human glyoxalase ii with cacodylate and acetate ions present in the active site (see paper)
27% identity, 80% coverage: 28:201/218 of query aligns to 15:173/260 of 1qh3A
Sites not aligning to the query:
2qedA Crystal structure of salmonella thyphimurium lt2 glyoxalase ii (see paper)
28% identity, 86% coverage: 15:201/218 of query aligns to 1:166/252 of 2qedA
2gcuA X-ray structure of gene product from arabidopsis thaliana at1g53580 (see paper)
28% identity, 78% coverage: 31:201/218 of query aligns to 23:183/244 of 2gcuA
Q9C8L4 Persulfide dioxygenase ETHE1 homolog, mitochondrial; Glyoxalase II; Glx II; Sulfur dioxygenase ETHE1; EC 1.13.11.18 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
28% identity, 78% coverage: 31:201/218 of query aligns to 72:232/294 of Q9C8L4
>WP_050750796.1 NCBI__GCF_000009985.1:WP_050750796.1
MTLQQFGDFGDFSLSVLVTSPPWYENCYLVVHKPTNTLAIVDPGGDGDRILEAVAATGAK
PEVIWLTHGHPDHLGAAHQIETTLGISTRAHADETQVISTSSDLNRTFTGQPQKGPGSLQ
TFTGEPTESLGGAPVRVIHTPGHTPGGICLDFGGFVLTGDTLFRNGVGRTDLPGGSEQQL
WASINRLLGLLDDDAMLFSGHGPEWAVREARRWWRMVG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory