SitesBLAST
Comparing WP_051181594.1 NCBI__GCF_000423825.1:WP_051181594.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
38% identity, 86% coverage: 47:329/330 of query aligns to 35:322/334 of 5aovA
- active site: L100 (≠ A111), R241 (= R246), D265 (= D270), E270 (≠ P276), H288 (= H296)
- binding glyoxylic acid: M52 (≠ N64), L53 (vs. gap), L53 (vs. gap), Y74 (≠ A85), A75 (= A86), V76 (≠ T87), G77 (= G88), R241 (= R246), H288 (= H296)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (≠ T87), T104 (≠ V115), F158 (= F168), G159 (= G169), R160 (≠ T170), I161 (≠ L171), S180 (≠ Q190), R181 (= R191), A211 (≠ H216), V212 (≠ C217), P213 (= P218), T218 (= T223), I239 (≠ T244), A240 (= A245), R241 (= R246), H288 (= H296), G290 (≠ A298)
5z20F The ternary structure of d-lactate dehydrogenase from pseudomonas aeruginosa with nadh and oxamate (see paper)
40% identity, 75% coverage: 80:328/330 of query aligns to 77:334/336 of 5z20F
- active site: S108 (≠ A111), R241 (= R246), D265 (= D270), E270 (= E275), H302 (= H296)
- binding 1,4-dihydronicotinamide adenine dinucleotide: Y107 (= Y110), G160 (= G169), Q161 (≠ T170), I162 (≠ L171), Y180 (≠ Q190), D181 (≠ R191), P182 (= P192), C212 (= C217), P213 (= P218), T218 (= T223), T239 (= T244), G240 (≠ A245), R241 (= R246), H302 (= H296), A304 (= A298)
3ddnB Crystal structure of hydroxypyruvic acid phosphate bound d-3- phosphoglycerate dehydrogenase in mycobacterium tuberculosis (see paper)
39% identity, 81% coverage: 56:322/330 of query aligns to 42:304/525 of 3ddnB
3dc2A Crystal structure of serine bound d-3-phosphoglycerate dehydrogenase from mycobacterium tuberculosis (see paper)
39% identity, 81% coverage: 56:322/330 of query aligns to 41:303/526 of 3dc2A
Sites not aligning to the query:
8atiA Human ctbp2(31-364) in complex with rai2 peptide(315-322)
36% identity, 82% coverage: 56:327/330 of query aligns to 43:321/330 of 8atiA
- binding nicotinamide-adenine-dinucleotide: S74 (≠ T87), T102 (≠ V115), G155 (= G167), G157 (= G169), R158 (≠ T170), T159 (≠ L171), D178 (≠ Q190), P179 (= P192), Y180 (≠ G193), H210 (= H216), C211 (= C217), N212 (≠ P218), A238 (≠ T244), R240 (= R246), H289 (= H296), A291 (= A298), W292 (= W299)
Sites not aligning to the query:
4lcjA Ctbp2 in complex with substrate mtob (see paper)
36% identity, 82% coverage: 56:327/330 of query aligns to 43:321/330 of 4lcjA
- active site: A98 (= A111), R240 (= R246), D264 (= D270), E269 (= E275), H289 (= H296)
- binding 4-(methylsulfanyl)-2-oxobutanoic acid: Y50 (≠ S63), H51 (≠ N64), I72 (≠ A85), G73 (≠ A86), S74 (≠ T87), G75 (= G88), R240 (= R246), H289 (= H296), W292 (= W299)
- binding nicotinamide-adenine-dinucleotide: S74 (≠ T87), T102 (≠ V115), I154 (≠ V166), G155 (= G167), G157 (= G169), R158 (≠ T170), T159 (≠ L171), D178 (≠ Q190), Y180 (≠ G193), H210 (= H216), C211 (= C217), N212 (≠ P218), N214 (≠ T220), N217 (≠ T223), A238 (≠ T244), A239 (= A245), R240 (= R246), H289 (= H296), W292 (= W299)
6biiA Crystal structure of pyrococcus yayanosii glyoxylate hydroxypyruvate reductase in complex with NADP and malonate (re-refinement of 5aow) (see paper)
37% identity, 86% coverage: 47:329/330 of query aligns to 34:321/332 of 6biiA
- active site: L99 (≠ V116), R240 (= R246), D264 (= D270), E269 (= E275), H287 (= H296)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V75 (≠ T87), T103 (≠ F120), G156 (= G167), F157 (= F168), G158 (= G169), R159 (≠ T170), I160 (≠ L171), A179 (vs. gap), R180 (vs. gap), S181 (≠ A189), K183 (≠ R191), V211 (≠ C217), P212 (= P218), E216 (= E222), T217 (= T223), V238 (≠ T244), A239 (= A245), R240 (= R246), D264 (= D270), H287 (= H296), G289 (≠ A298)
6plfA Crystal structure of human phgdh complexed with compound 1 (see paper)
33% identity, 83% coverage: 49:322/330 of query aligns to 35:305/305 of 6plfA
P56545 C-terminal-binding protein 2; CtBP2 from Homo sapiens (Human)
37% identity, 82% coverage: 56:327/330 of query aligns to 75:353/445 of P56545
O43175 D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; Malate dehydrogenase; EC 1.1.1.95; EC 1.1.1.399; EC 1.1.1.37 from Homo sapiens (Human) (see 3 papers)
33% identity, 83% coverage: 49:322/330 of query aligns to 39:309/533 of O43175
- T78 (= T87) binding
- R135 (= R144) to W: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606949
- RI 155:156 (≠ TL 170:171) binding
- D175 (vs. gap) binding
- T207 (≠ C217) binding
- CAR 234:236 (≠ TAR 244:246) binding
- D260 (= D270) binding
- V261 (= V271) to M: in PHGDHD; results in a four-fold decrease in substrate affinity and a slight increase in maximal enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs267606947
- HLGA 283:286 (≠ HIAW 296:299) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
- 373 A → T: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs201553627
- 377 G → S: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606948
- 425 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907988
- 490 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907987
6rj3A Crystal structure of phgdh in complex with compound 15 (see paper)
34% identity, 80% coverage: 49:313/330 of query aligns to 33:294/297 of 6rj3A
7ewhA Crystal structure of human phgdh in complex with homoharringtonine (see paper)
34% identity, 80% coverage: 49:313/330 of query aligns to 34:295/302 of 7ewhA
- binding (3beta)-O~3~-[(2R)-2,6-dihydroxy-2-(2-methoxy-2-oxoethyl)-6-methylheptanoyl]cephalotaxine: L146 (≠ V166), G147 (= G167), L148 (≠ F168), G149 (= G169), R150 (≠ T170), I151 (≠ L171), G152 (= G172), D170 (vs. gap), H201 (= H216), T202 (≠ C217), P203 (= P218)
6rihA Crystal structure of phgdh in complex with compound 9 (see paper)
34% identity, 80% coverage: 49:313/330 of query aligns to 34:295/302 of 6rihA
6plgA Crystal structure of human phgdh complexed with compound 15 (see paper)
34% identity, 80% coverage: 49:313/330 of query aligns to 34:295/303 of 6plgA
7dkmA Phgdh covalently linked to oridonin (see paper)
34% identity, 80% coverage: 49:313/330 of query aligns to 35:296/306 of 7dkmA
- binding nicotinamide-adenine-dinucleotide: T74 (= T87), A102 (≠ V115), G148 (= G167), R151 (≠ T170), I152 (≠ L171), Y170 (vs. gap), D171 (vs. gap), P172 (vs. gap), I173 (vs. gap), H202 (= H216), T203 (≠ C217), P204 (= P218), T209 (= T223), C230 (≠ T244), A231 (= A245), R232 (= R246), H279 (= H296), G281 (≠ A298)
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: E293 (≠ D310)
Sites not aligning to the query:
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: 14, 17, 18
6cwaA Crystal structure phgdh in complex with nadh and 3-phosphoglycerate at 1.77 a resolution (see paper)
34% identity, 80% coverage: 49:313/330 of query aligns to 33:294/299 of 6cwaA
- binding 1,4-dihydronicotinamide adenine dinucleotide: N96 (≠ A111), A100 (≠ V115), R149 (≠ T170), I150 (≠ L171), Y168 (vs. gap), D169 (vs. gap), P170 (vs. gap), I171 (vs. gap), H200 (= H216), T201 (≠ C217), P202 (= P218), T207 (= T223), C228 (≠ T244), A229 (= A245), R230 (= R246), H277 (= H296), G279 (≠ A298)
6rj5A Crystal structure of phgdh in complex with compound 39 (see paper)
34% identity, 80% coverage: 49:313/330 of query aligns to 34:295/301 of 6rj5A
6rj2A Crystal structure of phgdh in complex with compound 40 (see paper)
34% identity, 80% coverage: 49:313/330 of query aligns to 31:292/299 of 6rj2A
- binding ~{N}-[(1~{R})-1-[4-(ethanoylsulfamoyl)phenyl]ethyl]-2-methyl-5-phenyl-pyrazole-3-carboxamide: G146 (= G169), I148 (≠ L171), Y166 (vs. gap), D167 (vs. gap), P168 (vs. gap), I169 (vs. gap), I170 (≠ V188), H198 (= H216), T199 (≠ C217), L208 (= L226), R228 (= R246)
6cdfA Human ctbp1 (28-378) (see paper)
36% identity, 81% coverage: 56:322/330 of query aligns to 45:317/333 of 6cdfA
- binding 1,4-dihydronicotinamide adenine dinucleotide: T104 (≠ V115), G157 (= G167), R160 (≠ T170), V161 (≠ L171), Y179 (≠ A189), D180 (≠ Q190), P181 (= P192), Y182 (≠ G193), H212 (= H216), C213 (= C217), N219 (≠ T223), T240 (= T244), A241 (= A245), R242 (= R246), H291 (= H296), W294 (= W299)
6v89A Human ctbp1 (28-375) in complex with amp (see paper)
36% identity, 81% coverage: 56:322/330 of query aligns to 44:316/332 of 6v89A
Query Sequence
>WP_051181594.1 NCBI__GCF_000423825.1:WP_051181594.1
MHAHDAAATASTLKIAFLDLETLFPEDLDLGPLRELSPHCQFHPRTPPEALNDHLQAADI
VISNKTVISAEALRQAPRLKLICIAATGTNNVDLAAAGALGIPVCNVRNYATPSVVQHTF
ALMLALRNRLFDYHGDVMAGAWARAGQFCFLDHRFQELAGKTLGIVGFGTLGQAVARVAE
AFGMEVLVAQRPGAQPRTERLPLRELLPQVDVLSLHCPLTPETRGLIDADALARMRPDAL
LVNTARGGIVDEAALAAALRAGRLGGAGVDVLAEEPPVHGSPLLAPDVPRLIVTPHIAWA
SREARQRMVDELAANIRAFLAGMPRNLVTG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory