Comparing WP_051184350.1 NCBI__GCF_000422285.1:WP_051184350.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P10880 Shikimate kinase 2; SK 2; Shikimate kinase II; SKII; EC 2.7.1.71 from Dickeya chrysanthemi (Pectobacterium chrysanthemi) (Erwinia chrysanthemi) (see paper)
39% identity, 83% coverage: 3:166/197 of query aligns to 5:165/173 of P10880
1e6cA K15m mutant of shikimate kinase from erwinia chrysanthemi (see paper)
38% identity, 83% coverage: 3:166/197 of query aligns to 5:165/170 of 1e6cA
2shkB The three-dimensional structure of shikimate kinase from erwinia chrysanthemi complexed with adp (see paper)
37% identity, 83% coverage: 3:166/197 of query aligns to 5:155/162 of 2shkB
1shkA The three-dimensional structure of shikimate kinase from erwinia chrysanthemi (see paper)
35% identity, 83% coverage: 3:166/197 of query aligns to 5:150/158 of 1shkA
2iyvA Shikimate kinase from mycobacterium tuberculosis in complex with adp, open lid (conf. B) (see paper)
37% identity, 84% coverage: 4:169/197 of query aligns to 5:165/179 of 2iyvA
2iywA Shikimate kinase from mycobacterium tuberculosis in complex with mgatp, open lid (conf. B) (see paper)
37% identity, 84% coverage: 4:169/197 of query aligns to 5:165/178 of 2iywA
1zyuA Crystal structure of mycobacterium tuberculosis shikimate kinase in complex with shikimate and amppcp at 2.85 angstrom resolution (see paper)
37% identity, 84% coverage: 4:169/197 of query aligns to 5:165/168 of 1zyuA
4bqsA Crystal structure of mycobacterium tuberculosis shikimate kinase in complex with adp and a shikimic acid derivative. (see paper)
37% identity, 84% coverage: 4:169/197 of query aligns to 5:165/169 of 4bqsA
2iyyA Shikimate kinase from mycobacterium tuberculosis in complex with shikimate-3-phosphate and so4 (see paper)
37% identity, 84% coverage: 4:169/197 of query aligns to 5:165/169 of 2iyyA
3bafA Crystal structure of shikimate kinase from mycobacterium tuberculosis in complex with amp-pnp
37% identity, 84% coverage: 4:169/197 of query aligns to 5:165/165 of 3bafA
2dfnA Structure of shikimate kinase from mycobacterium tuberculosis complexed with adp and shikimate at 1.9 angstrons of resolution (see paper)
37% identity, 84% coverage: 4:169/197 of query aligns to 5:165/165 of 2dfnA
1we2A Crystal structure of shikimate kinase from mycobacterium tuberculosis in complex with mgadp and shikimic acid (see paper)
37% identity, 84% coverage: 4:169/197 of query aligns to 5:165/165 of 1we2A
1u8aA Crystal structure of mycobacterium tuberculosis shikimate kinase in complex with shikimate and adp at 2.15 angstrom resolution (see paper)
37% identity, 84% coverage: 4:169/197 of query aligns to 5:163/163 of 1u8aA
4y0aA Shikimate kinase from acinetobacter baumannii in complex with shikimate (see paper)
30% identity, 87% coverage: 2:173/197 of query aligns to 10:177/179 of 4y0aA
3n2eA Crystal structure of helicobactor pylori shikimate kinase in complex with nsc162535 (see paper)
31% identity, 77% coverage: 2:153/197 of query aligns to 3:146/168 of 3n2eA
3mufA Shikimate kinase from helicobacter pylori in complex with shikimate-3- phosphate and adp (see paper)
31% identity, 77% coverage: 2:153/197 of query aligns to 2:145/160 of 3mufA
Sites not aligning to the query:
1zuiA Structural basis for shikimate-binding specificity of helicobacter pylori shikimate kinase (see paper)
31% identity, 77% coverage: 2:153/197 of query aligns to 2:143/158 of 1zuiA
P07547 Pentafunctional AROM polypeptide; EC 4.2.3.4; EC 2.5.1.19; EC 2.7.1.71; EC 4.2.1.10; EC 1.1.1.25 from Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans) (see 2 papers)
42% identity, 43% coverage: 2:85/197 of query aligns to 865:950/1583 of P07547
Sites not aligning to the query:
6hqvA Pentafunctional arom complex from chaetomium thermophilum (see paper)
35% identity, 41% coverage: 2:81/197 of query aligns to 844:926/1555 of 6hqvA
Sites not aligning to the query:
7tbvA Crystal structure of the shikimate kinase + 3-dehydroquinate dehydratase + 3-dehydroshikimate dehydrogenase domains of aro1 from candida albicans (see paper)
33% identity, 41% coverage: 2:81/197 of query aligns to 5:86/682 of 7tbvA
Sites not aligning to the query:
>WP_051184350.1 NCBI__GCF_000422285.1:WP_051184350.1
MNIVLIGYRCSGKSTIGSLLAERLNRPFFDTDRAIEDRMERSIQDFIAMAGWASFRNAER
RTIQGLAGMDDLVIATGGGVVLDPQNISDLRANGWVVWLKADAAAIRRRMQQDPDAAICR
PPLAGGDACSEIERVLEARTALYESACDCALDATSRSPQAIADEILALLPWNRQAGETLP
GRSDLPEPVEKGSRHAR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory