Comparing WP_051241832.1 NCBI__GCF_000430725.1:WP_051241832.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
Q6FEQ3 Homoserine O-succinyltransferase; HST; Homoserine transsuccinylase; HTS; EC 2.3.1.46 from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) (see paper)
55% identity, 98% coverage: 3:388/393 of query aligns to 7:387/387 of Q6FEQ3
P45131 Homoserine O-acetyltransferase; HAT; Homoserine O-trans-acetylase; Homoserine transacetylase; HTA; EC 2.3.1.31 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 2 papers)
43% identity, 89% coverage: 16:365/393 of query aligns to 12:352/358 of P45131
Sites not aligning to the query:
5w8oB Homoserine transacetylase metx from mycobacterium hassiacum (see paper)
39% identity, 90% coverage: 18:369/393 of query aligns to 9:343/346 of 5w8oB
8f2lA Crystal structure of mycobacterium tuberculosis homoserine transacetylase in complex with l-homoserine (see paper)
37% identity, 89% coverage: 18:365/393 of query aligns to 18:358/367 of 8f2lA
7rytB Crystal structure of mycobacterium tuberculosis acetylated homoserine transacetylase with coenzyme a (see paper)
37% identity, 89% coverage: 18:365/393 of query aligns to 18:358/368 of 7rytB
6puxA Homoserine transacetylase metx from mycobacterium tuberculosis (see paper)
37% identity, 89% coverage: 18:365/393 of query aligns to 19:359/366 of 6puxA
D2Z028 L-serine/homoserine O-acetyltransferase; Homoserine O-trans-acetylase; EC 2.3.1.30; EC 2.3.1.31 from Streptomyces lavendulae (see paper)
38% identity, 92% coverage: 12:372/393 of query aligns to 12:374/374 of D2Z028
6ioiA Crystal structure of homoserine o-acetyltransferase in complex with coa from mycobacterium smegmatis atcc 19420 (see paper)
37% identity, 90% coverage: 18:369/393 of query aligns to 19:363/366 of 6ioiA
6iohA Crystal structure of homoserine o-acetyltransferase in complex with homoserine from mycobacterium smegmatis atcc 19420 (see paper)
37% identity, 90% coverage: 18:369/393 of query aligns to 19:363/375 of 6iohA
2vatA Crystal structure of deacetylcephalosporin c acetyltransferase in complex with coenzyme a (see paper)
35% identity, 89% coverage: 20:370/393 of query aligns to 20:347/347 of 2vatA
2vavB Crystal structure of deacetylcephalosporin c acetyltransferase (dac- soak) (see paper)
35% identity, 89% coverage: 20:370/393 of query aligns to 21:349/350 of 2vavB
Q10341 Serine O-succinyltransferase; SST; EC 2.3.1.- from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
36% identity, 85% coverage: 10:344/393 of query aligns to 82:408/504 of Q10341
Sites not aligning to the query:
>WP_051241832.1 NCBI__GCF_000430725.1:WP_051241832.1
MGSIGHVTPQRMHFPQPLPLKSGAQLPDYSLTYETYGTLNAARSNAVLVCHALNASHHVA
GTYAGQEKSEGWWDNLIGPGKPLDTNRFFVIGVNNPGSCFGSTGPKDLNPATGQPWGSDF
PVVTVEDWVNAQARLLDALGIEQLAAVIGGSLGGMQALSWTIQHPQRVRHALVIASAPNL
SAQNIAFNEVARRAICTDPEFHGGHFYAHGVVPQRGLRVARMIGHITYLSDDSMEAKFGR
ALRAAELAYSTQQIEFQIESYLRYQGDKFSEYFDANTYLLITRALDYFDPAREHGGDLSA
ALAKASAKFLVVSFTTDWRFSPLRSREIVQALLDNGRDVAYAEIDAPHGHDAFLLEDPRY
HGVVRAYFERVAAEAEAQAATAPAVAVSQREAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory