Comparing WP_051243215.1 NCBI__GCF_000430725.1:WP_051243215.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
O04373 IAA-amino acid hydrolase ILR1-like 4; jasmonoyl-L-amino acid hydrolase; EC 3.5.1.-; EC 3.5.1.127 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
40% identity, 95% coverage: 15:385/390 of query aligns to 49:423/440 of O04373
P54968 IAA-amino acid hydrolase ILR1; EC 3.5.1.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
39% identity, 96% coverage: 13:386/390 of query aligns to 50:428/442 of P54968
P54955 N-acetylcysteine deacetylase; S-(2-succino)cysteine metabolism operon protein P; EC 3.5.1.- from Bacillus subtilis (strain 168)
37% identity, 96% coverage: 14:386/390 of query aligns to 10:377/380 of P54955
4ewtA The crystal structure of a putative aminohydrolase from methicillin resistant staphylococcus aureus (see paper)
34% identity, 95% coverage: 3:374/390 of query aligns to 5:377/389 of 4ewtA
6slfA Nalpha-acylglutamine aminoacylase from corynebacterium sp.Releasing human axilla odorants co-crystallised with high affinity inhibitor (see paper)
39% identity, 82% coverage: 16:336/390 of query aligns to 21:344/398 of 6slfA
Sites not aligning to the query:
3ramA Crystal structure of hmra (see paper)
23% identity, 72% coverage: 14:293/390 of query aligns to 18:275/391 of 3ramA
Sites not aligning to the query:
7yh4A Crystal structure of human cytosolic beta-alanyl lysine dipeptidase (pm20d2)
25% identity, 89% coverage: 17:363/390 of query aligns to 28:353/400 of 7yh4A
>WP_051243215.1 NCBI__GCF_000430725.1:WP_051243215.1
MDLLSMSAEQSGEFVRLRRDIHRHPELGFEENRTSALVAEKLQAWGYQVERGLGGTGVVG
QLRRGGSARRLGLRADMDALPIQEATGLAHASCRPGLMHACGHDGHTAMLLAAARLLAAT
DFDGTLNLVFQPAEESLGGAVRMIEDGLFDKYPCDAIFSMHNMPGIAQGRLVLREGAMMA
SSDYVTITLHGTGGHGAMPHHTADPIVAAASIVMALQSIVARNVDPLQTAVVTVGAVHAG
QANNVIPQQARLELSVRALDREVRALLQQRIRDLVTAQAQSYGVRAEIDYRSGYTVLVND
AAQTALAREVALELLGPQRVELQGPPLTGSEDFAFMLERVPGSYVLIGNGDGQGNCMVHN
PGYDFNDDNIAIGAAFWVKLAQRFLEPGAG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory