Comparing WP_051301747.1 NCBI__GCF_000428045.1:WP_051301747.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
6j2lA Crystal structure of bi-functional enzyme (see paper)
43% identity, 81% coverage: 26:139/141 of query aligns to 14:133/200 of 6j2lA
Sites not aligning to the query:
7bgmA Crystal structure of mthisn2, a bifunctional enzyme from the histidine biosynthetic pathway (see paper)
41% identity, 77% coverage: 12:120/141 of query aligns to 1:109/213 of 7bgmA
Sites not aligning to the query:
7bgnA Crystal structure of mthisn2-amp complex, a bifunctional enzyme from the histidine biosynthetic pathway (see paper)
41% identity, 76% coverage: 14:120/141 of query aligns to 1:107/204 of 7bgnA
Sites not aligning to the query:
6j2lB Crystal structure of bi-functional enzyme (see paper)
43% identity, 68% coverage: 26:121/141 of query aligns to 13:102/185 of 6j2lB
Sites not aligning to the query:
>WP_051301747.1 NCBI__GCF_000428045.1:WP_051301747.1
MKESEKFKLGESLPLKQVLDSLPYNSDGLIPAIAQQHDTGEVLMMAWMNRVSLDETLEKG
RVCYWSRSRQKLWRKGESSGQVQLLKDMRFDCDGDTILLLVDQTGPACHTGRRTCFYNAV
RGDRVEVVSEPLIDPETLYGK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory