Comparing WP_051402380.1 NCBI__GCF_000496075.1:WP_051402380.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6aa8E Crystal structure of (s)-3-hydroxybutyryl-coenzymea dehydrogenase from clostridium acetobutylicum complexed with NAD+ (see paper)
53% identity, 97% coverage: 1:269/278 of query aligns to 11:279/281 of 6aa8E
Sites not aligning to the query:
4kugA Crystal structure of 3-hydroxybutylryl-coa dehydrogenase with NAD from clostridium butyricum
50% identity, 97% coverage: 1:269/278 of query aligns to 12:280/282 of 4kugA
Sites not aligning to the query:
4kuhA Crystal structure of 3-hydroxybutylryl-coa dehydrogenase with acetoacetyl-coa from clostridium butyricum
50% identity, 97% coverage: 1:269/278 of query aligns to 12:280/280 of 4kuhA
4pzeA Crystal structure of (s)-3-hydroxybutyryl-coa dehydrogenase paah1 in complex with acetoacetyl-coa (see paper)
48% identity, 97% coverage: 1:269/278 of query aligns to 13:281/283 of 4pzeA
4pzdA Crystal structure of (s)-3-hydroxybutyryl-coa dehydrogenase paah1 in complex with NAD+ (see paper)
48% identity, 97% coverage: 1:269/278 of query aligns to 13:281/283 of 4pzdA
Sites not aligning to the query:
9jheA 3-hydroxybutyryl-coa dehydrogenase with NAD (see paper)
43% identity, 98% coverage: 1:273/278 of query aligns to 11:282/289 of 9jheA
Sites not aligning to the query:
9jhyB 3-hydroxybutyryl-coa dehydrogenase mutant (s117a) with acetoacetyl coa (see paper)
44% identity, 98% coverage: 1:273/278 of query aligns to 11:278/285 of 9jhyB
P9WNP7 3-hydroxybutyryl-CoA dehydrogenase; Beta-hydroxybutyryl-CoA dehydrogenase; BHBD; EC 1.1.1.157 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
44% identity, 97% coverage: 1:269/278 of query aligns to 16:286/286 of P9WNP7
1f17A L-3-hydroxyacyl-coa dehydrogenase complexed with nadh (see paper)
39% identity, 98% coverage: 1:272/278 of query aligns to 15:293/293 of 1f17A
Sites not aligning to the query:
1f12A L-3-hydroxyacyl-coa dehydrogenase complexed with 3-hydroxybutyryl-coa (see paper)
39% identity, 98% coverage: 1:272/278 of query aligns to 15:293/293 of 1f12A
1f0yA L-3-hydroxyacyl-coa dehydrogenase complexed with acetoacetyl-coa and NAD+ (see paper)
39% identity, 97% coverage: 1:270/278 of query aligns to 15:291/291 of 1f0yA
Sites not aligning to the query:
Q16836 Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial; HCDH; Medium and short-chain L-3-hydroxyacyl-coenzyme A dehydrogenase; Short-chain 3-hydroxyacyl-CoA dehydrogenase; EC 1.1.1.35 from Homo sapiens (Human) (see 7 papers)
39% identity, 97% coverage: 1:270/278 of query aligns to 38:314/314 of Q16836
Sites not aligning to the query:
P00348 Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial; HCDH; L-3-hydroxyacyl CoA dehydrogenase; Medium and short-chain L-3-hydroxyacyl-coenzyme A dehydrogenase; Short-chain 3-hydroxyacyl-CoA dehydrogenase; EC 1.1.1.35 from Sus scrofa (Pig) (see paper)
38% identity, 97% coverage: 1:270/278 of query aligns to 38:314/314 of P00348
Sites not aligning to the query:
8oqoA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-49 (see paper)
36% identity, 97% coverage: 1:269/278 of query aligns to 344:615/727 of 8oqoA
Sites not aligning to the query:
8oqlA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-1 (see paper)
36% identity, 97% coverage: 1:269/278 of query aligns to 344:615/728 of 8oqlA
Sites not aligning to the query:
8oqrA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-80 (see paper)
36% identity, 97% coverage: 1:269/278 of query aligns to 345:616/728 of 8oqrA
Sites not aligning to the query:
8oqsB Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-83 (see paper)
36% identity, 97% coverage: 1:269/278 of query aligns to 351:622/735 of 8oqsB
Sites not aligning to the query:
8pf8A Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-72 (see paper)
36% identity, 97% coverage: 1:269/278 of query aligns to 345:616/729 of 8pf8A
Sites not aligning to the query:
8oquA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-92 (see paper)
36% identity, 97% coverage: 1:269/278 of query aligns to 346:617/730 of 8oquA
Sites not aligning to the query:
8oqtA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-91 (see paper)
36% identity, 97% coverage: 1:269/278 of query aligns to 345:616/729 of 8oqtA
Sites not aligning to the query:
>WP_051402380.1 NCBI__GCF_000496075.1:WP_051402380.1
MGSGIAHVCALAGYEVKLNDVSVERCEAGLATINGNLARQVSSGKIGEEARQSALRLISA
AASLEEMSDVDLVIESAIENEEVKRKILRELCPHLSPDAIVATNTSSISITRLASVSDRP
ERFIGIHFMNPVPVMELVELVRGIATEDVTFETARAFVTSLGKTIAVSEDFPAFMVNRIL
LPMINEAIYTLYEGVGTVEAIDTAMRLGARHPMGPLELADFIGLDTCLSIMQMLYEGLAD
SKYRPCPLLVKYVEAGWLGRKAQRGFYDYRGEKPVPTR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory