Comparing WP_051622996.1 NCBI__GCF_000711315.1:WP_051622996.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4eaaA X-ray crystal structure of the h141n mutant of perosamine n- acetyltransferase from caulobacter crescentus in complex with coa and gdp-perosamine (see paper)
36% identity, 76% coverage: 40:210/224 of query aligns to 40:208/210 of 4eaaA
Sites not aligning to the query:
4ea9A X-ray structure of gdp-perosamine n-acetyltransferase in complex with transition state analog at 0.9 angstrom resolution (see paper)
36% identity, 75% coverage: 42:210/224 of query aligns to 40:206/207 of 4ea9A
Sites not aligning to the query:
4ea8A X-ray crystal structure of perb from caulobacter crescentus in complex with coenzyme a and gdp-n-acetylperosamine at 1 angstrom resolution (see paper)
36% identity, 75% coverage: 42:210/224 of query aligns to 40:206/207 of 4ea8A
Sites not aligning to the query:
4m99A Acetyltransferase domain of pglb from neisseria gonorrhoeae fa1090 in complex with acetyl coenzyme a (see paper)
32% identity, 91% coverage: 5:207/224 of query aligns to 5:203/206 of 4m99A
P71063 UDP-N-acetylbacillosamine N-acetyltransferase; EC 2.3.1.203 from Bacillus subtilis (strain 168) (see paper)
29% identity, 90% coverage: 7:207/224 of query aligns to 6:204/216 of P71063
3bssA Pgld from campylobacter jejuni, nctc 11168, with native substrate (see paper)
26% identity, 73% coverage: 44:207/224 of query aligns to 25:191/194 of 3bssA
Sites not aligning to the query:
2vheA Pgld-coa complex: an acetyl transferase from campylobacter jejuni (see paper)
26% identity, 73% coverage: 44:207/224 of query aligns to 25:191/194 of 2vheA
Sites not aligning to the query:
3bsyA Pgld from campylobacter jejuni, nctc 11168, in complex with acetyl coenzyme a (see paper)
26% identity, 73% coverage: 44:207/224 of query aligns to 24:190/193 of 3bsyA
5t2yA Crystal structure of c. Jejuni pgld in complex with 5-methyl-4- (methylamino)-2-phenethylthieno[2,3-d]pyrimidine-6-carboxylic acid (see paper)
27% identity, 73% coverage: 44:207/224 of query aligns to 25:189/192 of 5t2yA
Q0P9D1 UDP-N-acetylbacillosamine N-acetyltransferase; Protein glycosylation D; UDP-4-amino-4,6-dideoxy-N-acetyl-alpha-D-glucosamine N-acetyltransferase; EC 2.3.1.203 from Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) (see 2 papers)
26% identity, 73% coverage: 44:207/224 of query aligns to 26:192/195 of Q0P9D1
Sites not aligning to the query:
5tyhA Pgld from campylobacter jejuni nctc 11168 in complex with 5-(2- furanyl)-1h-pyrazole-3-carboxylic acid (see paper)
27% identity, 73% coverage: 44:207/224 of query aligns to 22:182/185 of 5tyhA
7txsA X-ray structure of the viob n-aetyltransferase from acinetobacter baumannii in the presence of a reaction intermediate (see paper)
25% identity, 92% coverage: 5:211/224 of query aligns to 4:206/209 of 7txsA
7txqA X-ray structure of the viob n-acetyltransferase from acinetobacter baumannii in the present of tdp and acetyl-coenzymea (see paper)
25% identity, 92% coverage: 5:211/224 of query aligns to 4:206/209 of 7txqA
7txpA X-ray structure of the viob n-acetyltransferase from acinetobacter baumannii in complex with tdp-4-amino-4,6-dideoxy-d-glucose (see paper)
25% identity, 92% coverage: 5:211/224 of query aligns to 4:206/209 of 7txpA
8e73G2 qcr9 (see paper)
33% identity, 56% coverage: 95:219/224 of query aligns to 59:190/258 of 8e73G2
7l7yAAA Putative acetyl transferase protein (see paper)
25% identity, 62% coverage: 72:209/224 of query aligns to 73:215/217 of 7l7yAAA
Sites not aligning to the query:
7l82AAA Putative acetyl transferase protein (see paper)
25% identity, 62% coverage: 72:209/224 of query aligns to 73:215/216 of 7l82AAA
Sites not aligning to the query:
7l81AAA Putative acetyl transferase protein (see paper)
25% identity, 62% coverage: 72:209/224 of query aligns to 73:215/216 of 7l81AAA
Sites not aligning to the query:
7l7zAAA Putative acetyl transferase protein (see paper)
25% identity, 62% coverage: 72:209/224 of query aligns to 73:215/216 of 7l7zAAA
Sites not aligning to the query:
3r8yA Structure of the bacillus anthracis tetrahydropicolinate succinyltransferase
33% identity, 50% coverage: 96:207/224 of query aligns to 78:197/203 of 3r8yA
>WP_051622996.1 NCBI__GCF_000711315.1:WP_051622996.1
MKTPLLLIGGGGHCASVIDVIEANDSFEIVGIVEAPGAETKSLLGYPVIGTDDHLSELLK
TTQNCVITVGQIEHAAVRKSLFAKVKKLGGQLPSIVSPLARVARSARLGEGVVVMHHAIV
NHFASIGDNSIINHKALVEHGALVGKHCHISTSATLNGDVEVSDECFVGSGAVLVQGVMI
PENSLVGAGAVVTHHLQTPGVYVGCPAVLKKPRSISRDDHLGDN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory