Comparing WP_051952941.1 NCBI__GCF_000746085.1:WP_051952941.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4hzdA Crystal structure of serine acetyltransferase in complex with coenzyme a from brucella abortus strain s19 (see paper)
62% identity, 88% coverage: 16:259/277 of query aligns to 6:249/250 of 4hzdA
4h7oA Crystal structure of serine acetyltransferase from vibrio cholerae o1 biovar el tor n16961
53% identity, 90% coverage: 19:268/277 of query aligns to 5:254/258 of 4h7oA
8i04A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with serine (see paper)
51% identity, 91% coverage: 16:268/277 of query aligns to 2:254/258 of 8i04A
1ssqD Serine acetyltransferase- complex with cysteine (see paper)
51% identity, 90% coverage: 19:268/277 of query aligns to 5:254/257 of 1ssqD
1t3dA Crystal structure of serine acetyltransferase from e.Coli at 2.2a (see paper)
51% identity, 91% coverage: 16:268/277 of query aligns to 6:258/262 of 1t3dA
8i09A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with butyl gallate (see paper)
51% identity, 87% coverage: 16:256/277 of query aligns to 5:245/246 of 8i09A
8i06A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with coa (see paper)
51% identity, 86% coverage: 16:254/277 of query aligns to 6:244/244 of 8i06A
3gvdI Crystal structure of serine acetyltransferase cyse from yersinia pestis
50% identity, 91% coverage: 16:268/277 of query aligns to 9:261/272 of 3gvdI
1sstA Serine acetyltransferase- complex with coa (see paper)
50% identity, 85% coverage: 19:254/277 of query aligns to 5:233/233 of 1sstA
4n69A Soybean serine acetyltransferase complexed with serine (see paper)
49% identity, 85% coverage: 19:254/277 of query aligns to 8:243/243 of 4n69A
6wyeA Crystal structure of neisseria gonorrhoeae serine acetyltransferase (cyse) (see paper)
46% identity, 91% coverage: 19:270/277 of query aligns to 10:260/261 of 6wyeA
7ra4A Crystal structure of neisseria gonorrhoeae serine acetyltransferase (cyse) in complex with serine (see paper)
47% identity, 85% coverage: 19:254/277 of query aligns to 8:243/243 of 7ra4A
4n6bA Soybean serine acetyltransferase complexed with coa (see paper)
47% identity, 85% coverage: 19:254/277 of query aligns to 4:233/233 of 4n6bA
3p47A Crystal structure of entamoeba histolytica serine acetyltransferase 1 in complex with l-cysteine (see paper)
35% identity, 62% coverage: 74:246/277 of query aligns to 88:268/270 of 3p47A
3q1xA Crystal structure of entamoeba histolytica serine acetyltransferase 1 in complex with l-serine (see paper)
35% identity, 62% coverage: 74:246/277 of query aligns to 86:266/267 of 3q1xA
7bw9A Crystal structure of serine acetyltransferase isoform 3 in complex with cysteine from entamoeba histolytica
35% identity, 62% coverage: 86:256/277 of query aligns to 98:270/280 of 7bw9A
4mzuF Crystal structure of fdtd, a bifunctional ketoisomerase/n- acetyltransferase from shewanella denitrificans (see paper)
30% identity, 36% coverage: 171:269/277 of query aligns to 52:156/294 of 4mzuF
Sites not aligning to the query:
4mzuB Crystal structure of fdtd, a bifunctional ketoisomerase/n- acetyltransferase from shewanella denitrificans (see paper)
36% identity, 27% coverage: 180:255/277 of query aligns to 61:141/290 of 4mzuB
Sites not aligning to the query:
P07464 Galactoside O-acetyltransferase; GAT; Acetyl-CoA:galactoside 6-O-acetyltransferase; Thiogalactoside acetyltransferase; Thiogalactoside transacetylase; EC 2.3.1.18 from Escherichia coli (strain K12) (see 3 papers)
29% identity, 39% coverage: 150:256/277 of query aligns to 72:184/203 of P07464
Sites not aligning to the query:
1krvA Galactoside acetyltransferase in complex with coa and pnp-beta-gal (see paper)
29% identity, 39% coverage: 150:256/277 of query aligns to 71:183/201 of 1krvA
Sites not aligning to the query:
>WP_051952941.1 NCBI__GCF_000746085.1:WP_051952941.1
MTYVRGAAKIVDPAAIDPIFARLRNEAQEVVQNEPELAGAIFSTILGQGTLEAAIIHRIA
TRLGHQAAPADLIRQTYLDIIADQPSIGEAFRADIIAVVERDPACTRIIEPVFYFKGFQA
IQTHRLAHALWSAGRRDFALYLQSRSSEVFQTDIHPAARIGKGIFLDHATGLVIGATAVI
DDDVSMLQDVTLGGTGKEKGDRHPKVRSGVLIGAGAQILGNIEIGRCSRIAAGSVVLKPV
PDHKTVAGVPAKIVGEAGCAEPSRLMDQIIADGPIKK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory