Comparing WP_051953420.1 NCBI__GCF_000745855.1:WP_051953420.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4k28A 2.15 angstrom resolution crystal structure of a shikimate dehydrogenase family protein from pseudomonas putida kt2440 in complex with NAD+ (see paper)
44% identity, 88% coverage: 16:258/275 of query aligns to 2:248/266 of 4k28A
Sites not aligning to the query:
Q5HNV1 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Staphylococcus epidermidis (strain ATCC 35984 / RP62A) (see paper)
29% identity, 86% coverage: 23:259/275 of query aligns to 5:236/269 of Q5HNV1
Sites not aligning to the query:
3dooA Crystal structure of shikimate dehydrogenase from staphylococcus epidermidis complexed with shikimate (see paper)
28% identity, 86% coverage: 23:259/275 of query aligns to 5:227/258 of 3dooA
Sites not aligning to the query:
3tozA 2.2 angstrom crystal structure of shikimate 5-dehydrogenase from listeria monocytogenes in complex with NAD.
30% identity, 88% coverage: 13:255/275 of query aligns to 8:261/291 of 3tozA
Sites not aligning to the query:
Q8Y9N5 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
30% identity, 88% coverage: 13:255/275 of query aligns to 8:261/291 of Q8Y9N5
3tnlA 1.45 angstrom crystal structure of shikimate 5-dehydrogenase from listeria monocytogenes in complex with shikimate and NAD.
30% identity, 88% coverage: 13:255/275 of query aligns to 5:258/288 of 3tnlA
Sites not aligning to the query:
1nytA Shikimate dehydrogenase aroe complexed with NADP+ (see paper)
31% identity, 83% coverage: 23:249/275 of query aligns to 6:230/271 of 1nytA
Sites not aligning to the query:
P15770 Shikimate dehydrogenase (NADP(+)); SD; SDH; EC 1.1.1.25 from Escherichia coli (strain K12) (see paper)
31% identity, 83% coverage: 23:249/275 of query aligns to 6:230/272 of P15770
Sites not aligning to the query:
1o9bA Quinate/shikimate dehydrogenase ydib complexed with nadh (see paper)
28% identity, 85% coverage: 27:259/275 of query aligns to 10:253/280 of 1o9bA
1npdB X-ray structure of shikimate dehydrogenase complexed with NAD+ from e.Coli (ydib) northeast structural genomics research consortium (nesg) target er24 (see paper)
28% identity, 85% coverage: 27:259/275 of query aligns to 16:259/288 of 1npdB
P0A6D5 Quinate/shikimate dehydrogenase; NAD-dependent shikimate 5-dehydrogenase; EC 1.1.1.282 from Escherichia coli (strain K12) (see 4 papers)
28% identity, 85% coverage: 27:259/275 of query aligns to 16:259/288 of P0A6D5
Sites not aligning to the query:
Q9KVT3 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
31% identity, 71% coverage: 23:217/275 of query aligns to 10:201/278 of Q9KVT3
Sites not aligning to the query:
3pgjA 2.49 angstrom resolution crystal structure of shikimate 5- dehydrogenase (aroe) from vibrio cholerae o1 biovar eltor str. N16961 in complex with shikimate
31% identity, 71% coverage: 23:217/275 of query aligns to 6:197/272 of 3pgjA
Sites not aligning to the query:
2hk9B Crystal structure of shikimate dehydrogenase from aquifex aeolicus in complex with shikimate and NADP+ at 2.2 angstrom resolution (see paper)
25% identity, 86% coverage: 14:249/275 of query aligns to 2:229/267 of 2hk9B
Sites not aligning to the query:
2hk9A Crystal structure of shikimate dehydrogenase from aquifex aeolicus in complex with shikimate and NADP+ at 2.2 angstrom resolution (see paper)
25% identity, 86% coverage: 14:249/275 of query aligns to 2:229/269 of 2hk9A
Sites not aligning to the query:
O67049 Shikimate dehydrogenase (NADP(+)); SD; SDH; EC 1.1.1.25 from Aquifex aeolicus (strain VF5) (see paper)
25% identity, 86% coverage: 14:249/275 of query aligns to 2:229/269 of O67049
Sites not aligning to the query:
3sefC 2.4 angstrom resolution crystal structure of shikimate 5-dehydrogenase (aroe) from vibrio cholerae o1 biovar eltor str. N16961 in complex with shikimate and NADPH
31% identity, 68% coverage: 23:208/275 of query aligns to 6:189/244 of 3sefC
Sites not aligning to the query:
3sefA 2.4 angstrom resolution crystal structure of shikimate 5-dehydrogenase (aroe) from vibrio cholerae o1 biovar eltor str. N16961 in complex with shikimate and NADPH
31% identity, 71% coverage: 23:217/275 of query aligns to 6:193/268 of 3sefA
Sites not aligning to the query:
Q58484 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
28% identity, 88% coverage: 14:255/275 of query aligns to 2:247/282 of Q58484
1nvtB Crystal structure of shikimate dehydrogenase (aroe or mj1084) in complex with NADP+ (see paper)
28% identity, 88% coverage: 14:255/275 of query aligns to 7:252/287 of 1nvtB
Sites not aligning to the query:
>WP_051953420.1 NCBI__GCF_000745855.1:WP_051953420.1
MQGDNSVADTDIRLSGATRVHFIVGDPIAQVKSPQGVTQAFQARGLQAVVVPAHVAPDDL
ADWLRGVSLAQNVDGVIVTVPHKFASAALCATLSEQAAFLGAVNTLRRNADGRWHGDMFD
GLGCVQALRAHGCDPAGRRALLVGAGGAGTAIAHALVLAGVAQLAVHDGDAARRDALVGR
LAGLGRCPVAAGSADPAGFDLVVNASPAGMREDDPLPVQVEGLAPGTFVACVVTQPAVTP
LIAAARARGLDTSTGNDMFACVRDLMVDFLAEAAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory