SitesBLAST
Comparing WP_052474905.1 NCBI__GCF_000829435.1:WP_052474905.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
P15030 Fe(3+) dicitrate transport system permease protein FecC; Iron(III) dicitrate transport system permease protein FecC from Escherichia coli (strain K12) (see paper)
34% identity, 91% coverage: 26:332/336 of query aligns to 24:332/332 of P15030
- R60 (= R62) mutation to C: Retains 33% of wild-type citrate-mediated Fe(3+) transport.; mutation to E: Retains 29% of wild-type citrate-mediated Fe(3+) transport.
- R63 (= R65) mutation to C: Retains 74% of wild-type citrate-mediated Fe(3+) transport.; mutation to E: Retains 30% of wild-type citrate-mediated Fe(3+) transport.
- R302 (≠ K302) mutation to C: Retains 24% of wild-type citrate-mediated Fe(3+) transport.; mutation to E: Retains 28% of wild-type citrate-mediated Fe(3+) transport.
P15029 Fe(3+) dicitrate transport system permease protein FecD; Iron(III) dicitrate transport system permease protein FecD from Escherichia coli (strain K12) (see paper)
33% identity, 93% coverage: 19:330/336 of query aligns to 11:316/318 of P15029
- R51 (= R62) mutation to C: Retains 32% of wild-type citrate-mediated Fe(3+) transport.; mutation to E: Retains 14% of wild-type citrate-mediated Fe(3+) transport.
- R54 (= R65) mutation to C: Retains 19% of wild-type citrate-mediated Fe(3+) transport.; mutation to E: Retains 24% of wild-type citrate-mediated Fe(3+) transport.
- R288 (≠ K302) mutation to C: Retains 65% of wild-type citrate-mediated Fe(3+) transport.; mutation to E: Retains 35% of wild-type citrate-mediated Fe(3+) transport.
P06972 Iron(3+)-hydroxamate import system permease protein FhuB; Ferric hydroxamate uptake protein B; Ferrichrome transport system permease protein FhuB; Ferrichrome uptake protein FhuB; Iron(III)-hydroxamate import system permease protein FhuB from Escherichia coli (strain K12) (see paper)
33% identity, 97% coverage: 7:331/336 of query aligns to 344:658/660 of P06972
- R390 (= R62) Interaction with FhuD; mutation to A: Decreased binding to ferrichrome-FhuD.
- M484 (= M158) mutation to A: No effect on ATPase activity, but 80% decrease in Fe-ferrichrome transport efficiency of the FhuCB complex compared to wild-type; when associated with A-175; A-492 and A-495.; mutation to L: No effect on ATPase activity, but 50% decrease in Fe-ferrichrome transport efficiency of the FhuCB complex compared to wild-type; when associated with L-175; L-492 and L-495.
- M492 (≠ S166) mutation to A: No effect on ATPase activity, but 80% decrease in Fe-ferrichrome transport efficiency of the FhuCB complex compared to wild-type; when associated with A-175; A-484 and A-495.; mutation to L: No effect on ATPase activity, but 50% decrease in Fe-ferrichrome transport efficiency of the FhuCB complex compared to wild-type; when associated with L-175; L-484 and L-495.
- M495 (≠ T169) mutation to A: No effect on ATPase activity, but 80% decrease in Fe-ferrichrome transport efficiency of the FhuCB complex compared to wild-type; when associated with A-175; A-484 and A-492.; mutation to L: No effect on ATPase activity, but 50% decrease in Fe-ferrichrome transport efficiency of the FhuCB complex compared to wild-type; when associated with L-175; L-484 and L-492.
- Q507 (≠ D180) mutation to A: Decreased binding to ferrichrome-FhuD; when associated with A-510.
- T510 (≠ F183) mutation to A: Decreased binding to ferrichrome-FhuD; when associated with A-507.
- S515 (= S188) Interaction with FhuD; mutation to A: Loss of binding to ferrichrome-FhuD; when associated with A-517.
- Y517 (≠ S190) Interaction with FhuD; mutation to A: Loss of binding to ferrichrome-FhuD; when associated with A-515.
- Q636 (≠ E309) mutation to A: Decreased binding to ferrichrome-FhuD.
Sites not aligning to the query:
- 57 S→A: Decreased binding to ferrichrome-FhuD.
- 170 D→A: Loss of binding to ferrichrome-FhuD; when associated with A-171.
- 171 Q→A: Loss of binding to ferrichrome-FhuD; when associated with A-170.
- 175 M→A: No effect on ATPase activity, but 80% decrease in Fe-ferrichrome transport efficiency of the FhuCB complex compared to wild-type; when associated with A-484; A-492 and A-495.; M→L: No effect on ATPase activity, but 50% decrease in Fe-ferrichrome transport efficiency of the FhuCB complex compared to wild-type; when associated with L-484; L-492 and L-495.
- 182 Interaction with FhuD; T→A: Loss of binding to ferrichrome-FhuD; when associated with A-184.
- 184 Interaction with FhuD; T→A: Loss of binding to ferrichrome-FhuD; when associated with A-182.
- 304 Interaction with FhuD; E→A: Decreased binding to ferrichrome-FhuD.
5b57A Inward-facing conformation of abc heme importer bhuuv from burkholderia cenocepacia (see paper)
34% identity, 98% coverage: 7:334/336 of query aligns to 2:330/330 of 5b57A
Query Sequence
>WP_052474905.1 NCBI__GCF_000829435.1:WP_052474905.1
MASRNIKRRTIVITLGGLLLLVAAAISSLQYGSTNYSIQTVMDVLLSNEESGQASQIILD
IRMPRMVVALLIGGYLAVSGAIMQGLTRNALAEPGLLGISSGAAFVLVIALAIVPGLSTF
GTTAAAMLGATIAMVLIVLLASYVKGGASPVKLTLAGMAIGMFLTSLTTAISLYFDVTKD
MSFWYAGSLSTATWDDARLLVIFGAIAIPVLIYLLHPLTLLRFGEDVASSLGVRIKIVQL
LSIITILLLTGSSVSVAGAISFVGLIVPHISKMLVGGDFRYMIPVSTVLGSLLLVLADVG
SKLMNPPFETPVGVVTALLGVPFFLYLIQRKGGSMK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory