Comparing WP_052664513.1 NCBI__GCF_000969705.1:WP_052664513.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
1wa3D Mechanism of the class i kdpg aldolase (see paper)
37% identity, 92% coverage: 10:207/216 of query aligns to 6:197/203 of 1wa3D
6oviA Crystal structure of kdpg aldolase from legionella pneumophila with pyruvate captured at low ph as a covalent carbinolamine intermediate
35% identity, 87% coverage: 12:198/216 of query aligns to 11:197/210 of 6oviA
3vcrA Crystal structure of a putative kdpg (2-keto-3-deoxy-6- phosphogluconate) aldolase from oleispira antarctica (see paper)
37% identity, 84% coverage: 26:207/216 of query aligns to 25:212/216 of 3vcrA
Q6BF16 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; 2-oxo-3-deoxygalactonate 6-phosphate aldolase; 6-phospho-2-dehydro-3-deoxygalactonate aldolase; 6-phospho-2-keto-3-deoxygalactonate aldolase; KDPGal aldolase; EC 4.1.2.21 from Escherichia coli (strain K12) (see paper)
33% identity, 92% coverage: 15:212/216 of query aligns to 9:203/205 of Q6BF16
2v82A Kdpgal complexed to kdpgal (see paper)
34% identity, 92% coverage: 15:212/216 of query aligns to 8:202/205 of 2v82A
Sites not aligning to the query:
1mxsA Crystal structure of 2-keto-3-deoxy-6-phosphogluconate (kdpg) aldolase from pseudomonas putida. (see paper)
34% identity, 88% coverage: 13:202/216 of query aligns to 17:206/216 of 1mxsA
1euaA Schiff base intermediate in kdpg aldolase from escherichia coli (see paper)
39% identity, 85% coverage: 25:207/216 of query aligns to 27:209/213 of 1euaA
P0A955 KHG/KDPG aldolase; (4S)-4-hydroxy-2-oxoglutarate aldolase; 2-dehydro-3-deoxy-phosphogluconate aldolase; 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG aldolase; 2-keto-4-hydroxyglutarate aldolase; KHG aldolase; Ketohydroxyglutarate aldolase; Entner-Douderoff aldolase; Oxaloacetate decarboxylase; Phospho-2-dehydro-3-deoxygluconate aldolase; Phospho-2-keto-3-deoxygluconate aldolase; EC 4.1.3.42; EC 4.1.2.14; EC 4.1.1.112 from Escherichia coli (strain K12) (see 5 papers)
39% identity, 85% coverage: 25:207/216 of query aligns to 27:209/213 of P0A955
2c0aB Mechanism of the class i kdpg aldolase (see paper)
38% identity, 85% coverage: 25:207/216 of query aligns to 28:210/214 of 2c0aB
Sites not aligning to the query:
1wauA Structure of kdpg aldolase e45n mutant (see paper)
38% identity, 85% coverage: 25:207/216 of query aligns to 27:209/213 of 1wauA
5xsfA Crystal structure of the 2-keto-3-deoxy-6-phosphogluconate aldolase of zymomonas mobilis zm4 with 3-phosphoglycerate
34% identity, 94% coverage: 10:213/216 of query aligns to 9:207/209 of 5xsfA
>WP_052664513.1 NCBI__GCF_000969705.1:WP_052664513.1
MDQQSALAELRAAGVIAVLRAPSADHAVRTVDALVAGGVTGVEITYSTPDACTAIERIAT
EYGNDVQLGAGTVLTAGQARDAVAAGARFLVSPGTDPAVAEAMLDTGATVLLGALTPSEV
MTAVRLGAHAVKVFPASLGGPTYLRSLRGPFPDVPLVPTGGVNVANIGDWLAAGAVAVGA
GGELCSATAMAAGRWAEIEATARQFAEAHQRAAGHA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory