Comparing WP_052668355.1 NCBI__GCF_000969705.1:WP_052668355.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
Q9Y315 Deoxyribose-phosphate aldolase; DERA; 2-deoxy-D-ribose 5-phosphate aldolase; Phosphodeoxyriboaldolase; Deoxyriboaldolase; EC 4.1.2.4 from Homo sapiens (Human) (see paper)
42% identity, 86% coverage: 38:324/333 of query aligns to 20:309/318 of Q9Y315
6z9iB Escherichia coli d-2-deoxyribose-5-phosphate aldolase - n21k mutant complex with reaction products (see paper)
39% identity, 71% coverage: 67:304/333 of query aligns to 9:234/248 of 6z9iB
Sites not aligning to the query:
P0A6L0 Deoxyribose-phosphate aldolase; DERA; 2-deoxy-D-ribose 5-phosphate aldolase; Phosphodeoxyriboaldolase; Deoxyriboaldolase; EC 4.1.2.4 from Escherichia coli (strain K12) (see 2 papers)
39% identity, 71% coverage: 67:304/333 of query aligns to 11:236/259 of P0A6L0
Sites not aligning to the query:
5el1A Crystal structure of deoxyribose-phosphate aldolase from escherichia coli (k58e-y96w mutant) after acetaldehyde treatment (see paper)
39% identity, 71% coverage: 67:304/333 of query aligns to 9:234/248 of 5el1A
Sites not aligning to the query:
5ekyA Crystal structure of deoxyribose-phosphate aldolase from escherichia coli (k58e-y96w mutant) (see paper)
39% identity, 71% coverage: 67:304/333 of query aligns to 9:234/248 of 5ekyA
Sites not aligning to the query:
1jcjA Observation of covalent intermediates in an enzyme mechanism at atomic resolution (see paper)
39% identity, 71% coverage: 67:304/333 of query aligns to 12:237/252 of 1jcjA
Sites not aligning to the query:
7p76A Re-engineered 2-deoxy-d-ribose-5-phosphate aldolase catalysing asymmetric michael addition reactions, schiff base complex with cinnamaldehyde (see paper)
38% identity, 74% coverage: 67:313/333 of query aligns to 8:242/247 of 7p76A
3q2dA Optimization of the in silico designed kemp eliminase ke70 by computational design and directed evolution (see paper)
33% identity, 71% coverage: 67:304/333 of query aligns to 7:232/246 of 3q2dA
8forA Crystal structure of kemp eliminase ke70-core with bound transition state analogue
33% identity, 71% coverage: 67:304/333 of query aligns to 5:234/249 of 8forA
3ngjD Crystal structure of a putative deoxyribose-phosphate aldolase from entamoeba histolytica
34% identity, 65% coverage: 69:284/333 of query aligns to 12:202/222 of 3ngjD
Sites not aligning to the query:
Q4ZMV1 Deoxyribose-phosphate aldolase; DERA; 2-deoxy-D-ribose 5-phosphate aldolase; Phosphodeoxyriboaldolase; Deoxyriboaldolase; EC 4.1.2.4 from Pseudomonas syringae pv. syringae (strain B728a) (see paper)
32% identity, 62% coverage: 69:275/333 of query aligns to 11:192/226 of Q4ZMV1
1ub3A Crystal structure of tetrameric structure of aldolase from thermus thermophilus hb8 (see paper)
30% identity, 53% coverage: 108:284/333 of query aligns to 35:194/211 of 1ub3A
Sites not aligning to the query:
3qyqA 1.8 angstrom resolution crystal structure of a putative deoxyribose- phosphate aldolase from toxoplasma gondii me49 (see paper)
27% identity, 63% coverage: 103:312/333 of query aligns to 45:262/273 of 3qyqA
Sites not aligning to the query:
>WP_052668355.1 NCBI__GCF_000969705.1:WP_052668355.1
MSATSSRTLVLPGDAPDLREVTSSESALRRFLHGLPGVDEVGVEGRVAQLGTRSLKREAK
TWAIDLAIRAVDLTTLEGADTPGKVRSLAGKARQPDPSDPDCPSVAAVCVYPDMVATAVD
ALTGTDIHVAAVATAFPSGRSSLAIKQQDTRDAIEAGADEIDMVIDRGAFLAGDYGRVFE
EIVAIKAVCDEVGGSLDRDVHLKVILETGELQTYDNVRRASWLALAAGGDVIKTSTGKVS
PASTLPVTAVMLQAVRDWHALTGEHRGVKSAGGIRTAKDAIKYLVLVHEIAGAAWLHPDR
FRFGASSLLNDLLMQRAKQRTGHYWSPDRVTLD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory