SitesBLAST
Comparing WP_054029547.1 NCBI__GCF_001293685.1:WP_054029547.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4usaA Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with trans-cinnamaldehyde (see paper)
67% identity, 100% coverage: 1:906/907 of query aligns to 1:906/907 of 4usaA
- active site: I390 (= I390), F425 (= F425), R501 (= R501), F505 (= F505), R533 (= R533), E869 (= E869), L870 (= L870)
- binding bicarbonate ion: R460 (= R460), A531 (= A531), F532 (= F532), Y535 (= Y535), Q539 (= Q539)
- binding fe2/s2 (inorganic) cluster: V38 (≠ I38), C40 (= C40), E41 (≠ G41), G43 (≠ A43), C45 (= C45), G46 (= G46), C48 (= C48), R58 (= R58), C60 (= C60), C100 (= C100), G101 (= G101), C103 (= C103), C137 (= C137), C139 (= C139)
- binding hydrocinnamic acid: I255 (= I255), F425 (= F425), F494 (= F494), L497 (= L497), Y535 (= Y535), L626 (= L626)
- binding magnesium ion: E899 (= E899), E903 (≠ A903)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q99), C139 (= C139), T420 (= T420), F421 (= F421), G422 (= G422), R533 (= R533), W650 (= W650), H653 (= H653), G654 (= G654), Q655 (= Q655), G656 (= G656), S695 (≠ A695), G696 (= G696), G697 (= G697), Q700 (≠ S700), Q701 (= Q701), C799 (≠ N799), N800 (= N800), T804 (≠ V804), Q807 (= Q807), S865 (≠ A865), G866 (= G866), V867 (= V867), G868 (= G868), E869 (= E869)
4us9A Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with 3- phenylpropionaldehyde (see paper)
67% identity, 100% coverage: 1:906/907 of query aligns to 1:906/907 of 4us9A
- active site: I390 (= I390), F425 (= F425), R501 (= R501), F505 (= F505), R533 (= R533), E869 (= E869), L870 (= L870)
- binding 3-phenylpropanal: I255 (= I255), F257 (= F257), P258 (= P258), H752 (≠ N752)
- binding bicarbonate ion: R460 (= R460), L498 (= L498), A531 (= A531), F532 (= F532), Y535 (= Y535), Q539 (= Q539), R890 (= R890), Y892 (≠ R892)
- binding fe2/s2 (inorganic) cluster: V38 (≠ I38), C40 (= C40), E41 (≠ G41), G43 (≠ A43), C45 (= C45), G46 (= G46), C48 (= C48), R58 (= R58), C60 (= C60), C100 (= C100), G101 (= G101), C103 (= C103), C137 (= C137), C139 (= C139)
- binding magnesium ion: E899 (= E899), E903 (≠ A903)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q99), C139 (= C139), T420 (= T420), F421 (= F421), G422 (= G422), R533 (= R533), W650 (= W650), H653 (= H653), G654 (= G654), Q655 (= Q655), G656 (= G656), S695 (≠ A695), G696 (= G696), G697 (= G697), Q700 (≠ S700), Q701 (= Q701), C799 (≠ N799), N800 (= N800), T804 (≠ V804), Q807 (= Q807), S865 (≠ A865), G866 (= G866), V867 (= V867), G868 (= G868), E869 (= E869)
4us8A Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with benzaldehyde (see paper)
67% identity, 100% coverage: 1:906/907 of query aligns to 1:906/907 of 4us8A
- active site: I390 (= I390), F425 (= F425), R501 (= R501), F505 (= F505), R533 (= R533), E869 (= E869), L870 (= L870)
- binding bicarbonate ion: R460 (= R460), L498 (= L498), A531 (= A531), F532 (= F532), Y535 (= Y535), Q539 (= Q539)
- binding fe2/s2 (inorganic) cluster: V38 (≠ I38), C40 (= C40), E41 (≠ G41), G43 (≠ A43), C45 (= C45), G46 (= G46), C48 (= C48), R58 (= R58), C60 (= C60), C100 (= C100), G101 (= G101), C103 (= C103), C137 (= C137), C139 (= C139)
- binding benzaldehyde: I255 (= I255), I255 (= I255), L394 (= L394), F425 (= F425), F425 (= F425), F425 (= F425), F425 (= F425), L497 (= L497), L497 (= L497), R501 (= R501), A531 (= A531), Y535 (= Y535), Y535 (= Y535), L626 (= L626), L626 (= L626), L626 (= L626), P694 (= P694), G696 (= G696), G697 (= G697)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q99), C139 (= C139), T420 (= T420), F421 (= F421), G422 (= G422), R533 (= R533), H653 (= H653), G654 (= G654), Q655 (= Q655), G656 (= G656), S695 (≠ A695), G696 (= G696), G697 (= G697), Q700 (≠ S700), Q701 (= Q701), C799 (≠ N799), N800 (= N800), T804 (≠ V804), Q807 (= Q807), S865 (≠ A865), G866 (= G866), V867 (= V867), G868 (= G868), E869 (= E869)
4c7yA Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with sodium dithionite and sodium sulfide (see paper)
67% identity, 100% coverage: 1:906/907 of query aligns to 1:906/907 of 4c7yA
- active site: I390 (= I390), F425 (= F425), R501 (= R501), F505 (= F505), R533 (= R533), E869 (= E869), L870 (= L870)
- binding bicarbonate ion: R460 (= R460), L498 (= L498), A531 (= A531), Y535 (= Y535), Q539 (= Q539)
- binding fe2/s2 (inorganic) cluster: C40 (= C40), E41 (≠ G41), G43 (≠ A43), C45 (= C45), G46 (= G46), C48 (= C48), R58 (= R58), C60 (= C60), C100 (= C100), G101 (= G101), C103 (= C103), C137 (= C137), C139 (= C139)
- binding magnesium ion: E899 (= E899), E903 (≠ A903)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q99), C139 (= C139), T420 (= T420), F421 (= F421), G422 (= G422), R533 (= R533), W650 (= W650), H653 (= H653), G654 (= G654), Q655 (= Q655), G656 (= G656), S695 (≠ A695), G696 (= G696), Q700 (≠ S700), Q701 (= Q701), C799 (≠ N799), N800 (= N800), T804 (≠ V804), Q807 (= Q807), S865 (≠ A865), G866 (= G866), V867 (= V867), G868 (= G868), E869 (= E869)
- binding hydrogen peroxide: G696 (= G696), G697 (= G697), E869 (= E869)
3fc4A Ethylene glycol inhibited form of aldehyde oxidoreductase from desulfovibrio gigas (see paper)
67% identity, 100% coverage: 1:906/907 of query aligns to 1:906/907 of 3fc4A
- active site: I390 (= I390), F425 (= F425), R501 (= R501), F505 (= F505), R533 (= R533), E869 (= E869), L870 (= L870)
- binding 1,2-ethanediol: Y535 (= Y535), Y622 (= Y622), G696 (= G696), G697 (= G697), E869 (= E869)
- binding fe2/s2 (inorganic) cluster: V38 (≠ I38), C40 (= C40), E41 (≠ G41), G43 (≠ A43), C45 (= C45), G46 (= G46), C48 (= C48), R58 (= R58), C60 (= C60), C100 (= C100), G101 (= G101), C103 (= C103), C137 (= C137), C139 (= C139)
- binding magnesium ion: E899 (= E899), E903 (≠ A903)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q99), C139 (= C139), G419 (= G419), T420 (= T420), F421 (= F421), G422 (= G422), R533 (= R533), W650 (= W650), H653 (= H653), G654 (= G654), Q655 (= Q655), G656 (= G656), S695 (≠ A695), G696 (= G696), Q700 (≠ S700), Q701 (= Q701), C799 (≠ N799), N800 (= N800), T804 (≠ V804), Q807 (= Q807), S865 (≠ A865), G866 (= G866), V867 (= V867), G868 (= G868), E869 (= E869)
3fahA Glycerol inhibited form of aldehyde oxidoreductase from desulfovibrio gigas (see paper)
67% identity, 100% coverage: 1:906/907 of query aligns to 1:906/907 of 3fahA
- active site: I390 (= I390), F425 (= F425), R501 (= R501), F505 (= F505), R533 (= R533), E869 (= E869), L870 (= L870)
- binding fe2/s2 (inorganic) cluster: V38 (≠ I38), C40 (= C40), E41 (≠ G41), G43 (≠ A43), C45 (= C45), G46 (= G46), C48 (= C48), R58 (= R58), C60 (= C60), C100 (= C100), G101 (= G101), C103 (= C103), C137 (= C137), C139 (= C139)
- binding glycerol: P416 (= P416), Y535 (= Y535), Y622 (= Y622), W683 (≠ M683), G696 (= G696), G697 (= G697), E869 (= E869), K884 (≠ H884), V889 (= V889), R890 (= R890), Y892 (≠ R892)
- binding magnesium ion: E899 (= E899), E903 (≠ A903)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q99), C139 (= C139), G419 (= G419), T420 (= T420), F421 (= F421), G422 (= G422), R533 (= R533), W650 (= W650), H653 (= H653), G654 (= G654), Q655 (= Q655), G656 (= G656), S695 (≠ A695), G696 (= G696), Q700 (≠ S700), Q701 (= Q701), C799 (≠ N799), N800 (= N800), T804 (≠ V804), Q807 (= Q807), S865 (≠ A865), G866 (= G866), V867 (= V867), G868 (= G868), E869 (= E869)
1sijA Crystal structure of the aldehyde dehydrogenase (a.K.A. Aor or mop) of desulfovibrio gigas covalently bound to [aso3]- (see paper)
67% identity, 100% coverage: 1:906/907 of query aligns to 1:906/907 of 1sijA
- active site: I390 (= I390), F425 (= F425), R501 (= R501), F505 (= F505), R533 (= R533), E869 (= E869), L870 (= L870)
- binding arsenite: Y535 (= Y535), G696 (= G696), G697 (= G697), E869 (= E869)
- binding fe2/s2 (inorganic) cluster: V38 (≠ I38), C40 (= C40), E41 (≠ G41), G43 (≠ A43), C45 (= C45), G46 (= G46), C48 (= C48), R58 (= R58), C60 (= C60), Q99 (= Q99), C100 (= C100), G101 (= G101), C103 (= C103), C137 (= C137), C139 (= C139)
- binding magnesium ion: E899 (= E899), E903 (≠ A903)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q99), C139 (= C139), T420 (= T420), F421 (= F421), G422 (= G422), R533 (= R533), H653 (= H653), G654 (= G654), Q655 (= Q655), G656 (= G656), S695 (≠ A695), G696 (= G696), S698 (= S698), Q700 (≠ S700), Q701 (= Q701), C799 (≠ N799), N800 (= N800), T804 (≠ V804), Q807 (= Q807), S865 (≠ A865), G866 (= G866), V867 (= V867), G868 (= G868), E869 (= E869)
Q46509 Aldehyde oxidoreductase; Molybdenum iron sulfur protein; EC 1.2.99.7 from Megalodesulfovibrio gigas (Desulfovibrio gigas) (see paper)
67% identity, 100% coverage: 1:906/907 of query aligns to 1:906/907 of Q46509
- C40 (= C40) binding [2Fe-2S] cluster
- C45 (= C45) binding [2Fe-2S] cluster
- C48 (= C48) binding [2Fe-2S] cluster
- C60 (= C60) binding [2Fe-2S] cluster
- C100 (= C100) binding [2Fe-2S] cluster
- C103 (= C103) binding [2Fe-2S] cluster
- C137 (= C137) binding [2Fe-2S] cluster
- C139 (= C139) binding [2Fe-2S] cluster
1dgjA Crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774 (see paper)
65% identity, 100% coverage: 1:905/907 of query aligns to 1:905/906 of 1dgjA
- active site: V391 (≠ I390), F427 (= F425), R503 (= R501), Y507 (≠ F505), R535 (= R533), E869 (= E869), M870 (≠ L870)
- binding molybdenum (iv)oxide: G424 (= G422), R535 (= R533), G698 (= G696), E869 (= E869)
- binding fe2/s2 (inorganic) cluster: V38 (≠ I38), G39 (= G39), C40 (= C40), G41 (= G41), G43 (≠ A43), Q44 (= Q44), C45 (= C45), G46 (= G46), C48 (= C48), R58 (= R58), C60 (= C60), C100 (= C100), G101 (= G101), C103 (= C103), C137 (= C137), C139 (= C139)
- binding pterin cytosine dinucleotide: Q99 (= Q99), C139 (= C139), F423 (= F421), G424 (= G422), R535 (= R533), W652 (= W650), H655 (= H653), G656 (= G654), Q657 (= Q655), G658 (= G656), A697 (= A695), G698 (= G696), S700 (= S698), S702 (= S700), Q703 (= Q701), C799 (≠ N799), N800 (= N800), V803 (= V803), V804 (= V804), Q807 (= Q807), S865 (≠ A865), G866 (= G866), V867 (= V867), G868 (= G868), E869 (= E869)
3am9A Complex of bovine xanthine dehydrogenase and trihydroxy fyx-051 (see paper)
27% identity, 86% coverage: 129:904/907 of query aligns to 488:1274/1293 of 3am9A
- active site: Q733 (≠ I390), E768 (≠ F425), R846 (= R501), H850 (≠ F505), R878 (= R533), G1226 (= G868), E1227 (= E869)
- binding bicarbonate ion: R805 (= R460), H806 (≠ S461), T875 (≠ S530), A876 (= A531), F877 (= F532), Q884 (= Q539)
- binding calcium ion: H707 (= H365), Y709 (≠ T367), T802 (= T457), G803 (= G458), A833 (≠ H488), S836 (≠ Y491), R837 (≠ S492), S840 (≠ G495), S873 (≠ W528), N874 (≠ G529)
- binding fe2/s2 (inorganic) cluster: L710 (≠ M368)
- binding 4-[5-(2,6-dioxo-1,2,3,6-tetrahydropyridin-4-yl)-1H-1,2,4-triazol-3-yl]-6-oxo-1,6-dihydropyridine-2-carbonitrile: L614 (= L254), E768 (≠ F425), L839 (≠ F494), S842 (≠ L497), R846 (= R501), F880 (≠ Y535), F975 (≠ L626), L980 (≠ A629), A1045 (≠ G697), E1227 (= E869)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 43, 44, 228, 229, 231, 232, 233, 234, 235, 236, 309, 310, 314, 318, 319, 322, 323, 325, 326, 332, 376, 394
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 111, 112, 114, 146, 148
1v97A Crystal structure of bovine milk xanthine dehydrogenase fyx-051 bound form (see paper)
27% identity, 86% coverage: 129:904/907 of query aligns to 488:1274/1298 of 1v97A
- active site: Q733 (≠ I390), E768 (≠ F425), R846 (= R501), H850 (≠ F505), R878 (= R533), G1226 (= G868), E1227 (= E869)
- binding calcium ion: A833 (≠ H488), S836 (≠ Y491), R837 (≠ S492), S840 (≠ G495), S873 (≠ W528), N874 (≠ G529)
- binding fe2/s2 (inorganic) cluster: L710 (≠ M368)
- binding 4-(5-pyridin-4-yl-1h-1,2,4-triazol-3-yl)pyridine-2-carbonitrile: E768 (≠ F425), L839 (≠ F494), R846 (= R501), F880 (≠ Y535), F975 (≠ L626), L980 (≠ A629), P1042 (= P694), A1044 (≠ G696), A1045 (≠ G697), E1227 (= E869)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 43, 44, 228, 229, 230, 231, 232, 233, 234, 235, 236, 309, 310, 318, 319, 322, 323, 325, 326, 331, 332, 375, 376
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 110, 111, 112, 114, 146, 148
2ckjA Human milk xanthine oxidoreductase
28% identity, 82% coverage: 158:904/907 of query aligns to 495:1252/1264 of 2ckjA
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 228, 230, 231, 232, 233, 234, 308, 309, 317, 318, 321, 322, 324, 325, 331, 375
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 111, 112, 114, 146, 147, 148
1vdvA Bovine milk xanthine dehydrogenase y-700 bound form (see paper)
26% identity, 86% coverage: 129:904/907 of query aligns to 488:1275/1299 of 1vdvA
- active site: Q734 (≠ I390), E769 (≠ F425), R847 (= R501), H851 (≠ F505), R879 (= R533), G1227 (= G868), E1228 (= E869)
- binding calcium ion: H708 (= H365), Y710 (≠ T367), T803 (= T457), G804 (= G458), A834 (≠ H488), S837 (≠ Y491), R838 (≠ S492), S841 (≠ G495), S874 (≠ W528), N875 (≠ G529)
- binding fe2/s2 (inorganic) cluster: L711 (≠ M368)
- binding 1-[3-cyano-4-(neopentyloxy)phenyl]-1h-pyrazole-4-carboxylic acid: E769 (≠ F425), L840 (≠ F494), S843 (≠ L497), R847 (= R501), F881 (≠ Y535), F976 (≠ L626), T977 (≠ D627), V978 (vs. gap), L981 (≠ A629), P1043 (= P694), A1046 (≠ G697)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 43, 44, 229, 230, 231, 232, 233, 234, 235, 236, 309, 310, 318, 319, 322, 323, 325, 326, 331, 332, 375, 376
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 110, 111, 112, 114, 146, 148
1fo4A Crystal structure of xanthine dehydrogenase isolated from bovine milk (see paper)
26% identity, 86% coverage: 129:904/907 of query aligns to 488:1275/1299 of 1fo4A
- active site: Q734 (≠ I390), E769 (≠ F425), R847 (= R501), H851 (≠ F505), R879 (= R533), G1227 (= G868), E1228 (= E869)
- binding calcium ion: A834 (≠ H488), S837 (≠ Y491), R838 (≠ S492), S841 (≠ G495), S874 (≠ W528), N875 (≠ G529)
- binding fe2/s2 (inorganic) cluster: L711 (≠ M368)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 43, 44, 228, 229, 230, 231, 232, 233, 234, 235, 236, 309, 310, 318, 319, 322, 323, 325, 331, 332, 375, 376
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 110, 111, 112, 114, 146, 147, 148
2e1qA Crystal structure of human xanthine oxidoreductase mutant, glu803val (see paper)
27% identity, 83% coverage: 152:904/907 of query aligns to 520:1283/1307 of 2e1qA
- active site: Q742 (≠ I390), V777 (≠ F425), R855 (= R501), H859 (≠ F505), R887 (= R533), G1235 (= G868), E1236 (= E869)
- binding bicarbonate ion: R814 (= R460), H815 (≠ S461), I852 (≠ L498), F886 (= F532), F889 (≠ Y535), G890 (= G536), Q893 (= Q539)
- binding calcium ion: E715 (≠ P364), H716 (= H365), Y718 (≠ T367), T741 (≠ S389), T747 (≠ H395), S780 (= S426), T781 (≠ P427), S784 (≠ E430), T811 (= T457), G812 (= G458)
- binding fe2/s2 (inorganic) cluster: L719 (≠ M368)
- binding hydroxy(dioxo)molybdenum: F773 (= F421), G774 (= G422), R887 (= R533), A1053 (≠ G696), A1054 (≠ G697), E1236 (= E869)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 43, 44, 230, 231, 232, 233, 234, 235, 236, 237, 238, 311, 312, 316, 320, 321, 324, 325, 327, 328, 333, 334, 377, 378
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 110, 111, 112, 114, 146, 148
3bdjA Crystal structure of bovine milk xanthine dehydrogenase with a covalently bound oxipurinol inhibitor (see paper)
27% identity, 81% coverage: 166:904/907 of query aligns to 521:1270/1286 of 3bdjA
- active site: Q729 (≠ I390), E764 (≠ F425), R842 (= R501), H846 (≠ F505), R874 (= R533), G1222 (= G868), E1223 (= E869)
- binding Oxypurinol: E764 (≠ F425), R842 (= R501), F876 (≠ Y535), F971 (≠ L626), T972 (≠ D627), A1040 (≠ G696), A1041 (≠ G697), E1223 (= E869)
- binding calcium ion: A829 (≠ H488), S832 (≠ Y491), R833 (≠ S492), S836 (≠ G495), S869 (≠ W528), N870 (≠ G529)
- binding carbonate ion: R801 (= R460), H802 (≠ S461), T871 (≠ S530), A872 (= A531), F876 (≠ Y535), G877 (= G536), Q880 (= Q539)
- binding fe2/s2 (inorganic) cluster: L706 (≠ M368)
- binding Oxo(sulfanyl)molybdenum(IV) ION: G761 (= G422), A872 (= A531), F873 (= F532), R874 (= R533), E1223 (= E869)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 43, 44, 227, 228, 229, 230, 231, 232, 233, 234, 307, 308, 316, 317, 320, 321, 323, 324, 329, 330, 373, 374
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 110, 111, 112, 114, 146, 148
3amzA Bovine xanthine oxidoreductase urate bound form (see paper)
27% identity, 81% coverage: 166:904/907 of query aligns to 523:1272/1291 of 3amzA
- active site: Q731 (≠ I390), E766 (≠ F425), R844 (= R501), H848 (≠ F505), R876 (= R533), G1224 (= G868), E1225 (= E869)
- binding bicarbonate ion: R803 (= R460), H804 (≠ S461), T873 (≠ S530), A874 (= A531), F878 (≠ Y535), G879 (= G536), Q882 (= Q539)
- binding calcium ion: A831 (≠ H488), S834 (≠ Y491), R835 (≠ S492), S838 (≠ G495), S871 (≠ W528), N872 (≠ G529)
- binding fe2/s2 (inorganic) cluster: L708 (≠ M368)
- binding 1,4-dihydronicotinamide adenine dinucleotide: S1189 (vs. gap)
- binding uric acid: E766 (≠ F425), R844 (= R501), F878 (≠ Y535), F973 (≠ L626), T974 (≠ D627), A1043 (≠ G697), E1225 (= E869)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 44, 229, 230, 231, 232, 233, 234, 235, 236, 309, 318, 319, 322, 323, 325, 326, 331, 332, 375, 376
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 110, 111, 112, 114, 146, 148
- binding 1,4-dihydronicotinamide adenine dinucleotide: 328, 329, 330, 365, 366, 402, 403, 430, 432, 433, 473, 480
1n5xA Xanthine dehydrogenase from bovine milk with inhibitor tei-6720 bound (see paper)
26% identity, 86% coverage: 129:904/907 of query aligns to 488:1275/1290 of 1n5xA
- active site: Q734 (≠ I390), E769 (≠ F425), R847 (= R501), H851 (≠ F505), R879 (= R533), G1227 (= G868), E1228 (= E869)
- binding fe2/s2 (inorganic) cluster: L711 (≠ M368)
- binding 2-(3-cyano-4-isobutoxy-phenyl)-4-methyl-5-thiazole-carboxylic acid: L615 (= L254), K738 (≠ L394), E769 (≠ F425), L840 (≠ F494), R847 (= R501), F881 (≠ Y535), F976 (≠ L626), T977 (≠ D627), V978 (vs. gap), L981 (≠ A629)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 43, 44, 229, 231, 232, 233, 234, 235, 236, 309, 310, 318, 319, 322, 323, 325, 326, 332, 376
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 110, 111, 112, 114, 146, 148
P80457 Xanthine dehydrogenase/oxidase; EC 1.17.1.4; EC 1.17.3.2 from Bos taurus (Bovine) (see 5 papers)
27% identity, 81% coverage: 166:904/907 of query aligns to 559:1308/1332 of P80457
- Q767 (≠ I390) binding Mo-molybdopterin
- F798 (= F421) binding Mo-molybdopterin
- R912 (= R533) binding Mo-molybdopterin
- A1079 (≠ G697) binding Mo-molybdopterin
- E1261 (= E869) active site, Proton acceptor
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 43 binding [2Fe-2S] cluster
- 48 binding [2Fe-2S] cluster
- 51 binding [2Fe-2S] cluster
- 73 binding [2Fe-2S] cluster
- 113 binding [2Fe-2S] cluster
- 116 binding [2Fe-2S] cluster
- 148 binding [2Fe-2S] cluster
- 150 binding [2Fe-2S] cluster
- 257:264 binding FAD
- 335 R→A: Promotes conversion to the oxidase form that utilizes molecular oxygen as electron acceptor. Interferes with normal conversion to the dehydrogenase form by reducing agents.
- 336 W→A: Promotes conversion to the oxidase form that utilizes molecular oxygen as electron acceptor. Interferes with normal conversion to the dehydrogenase form by reducing agents.
- 337 binding FAD
- 347:351 binding FAD
- 360 binding FAD
- 404 binding FAD
- 422 binding FAD
- 427 R→Q: Promotes conversion to the oxidase form that utilizes molecular oxygen as electron acceptor. Interferes with normal conversion to the dehydrogenase form by reducing agents.
3unaA Crystal structure of bovine milk xanthine dehydrogenase with NAD bound (see paper)
27% identity, 81% coverage: 166:904/907 of query aligns to 521:1270/1286 of 3unaA
- active site: Q729 (≠ I390), E764 (≠ F425), R842 (= R501), H846 (≠ F505), R874 (= R533), G1222 (= G868), E1223 (= E869)
- binding calcium ion: A829 (≠ H488), S832 (≠ Y491), R833 (≠ S492), S836 (≠ G495), S869 (≠ W528), N870 (≠ G529)
- binding carbonate ion: R801 (= R460), H802 (≠ S461), T871 (≠ S530), A872 (= A531), F876 (≠ Y535), G877 (= G536), Q880 (= Q539)
- binding fe2/s2 (inorganic) cluster: L706 (≠ M368)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 43, 44, 227, 228, 229, 230, 231, 232, 233, 234, 307, 308, 316, 317, 320, 321, 323, 324, 329, 330, 373, 374
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 110, 111, 112, 114, 146, 148
- binding nicotinamide-adenine-dinucleotide: 327, 363, 364, 430, 431, 471, 478
Query Sequence
>WP_054029547.1 NCBI__GCF_001293685.1:WP_054029547.1
MMKRTLHVNGVPRTVIVEADQSLANVLREQLGLTGTKIGCGQAQCGCCNVILDDKLVRSC
VTKMSKVADGSTVITVEGIGNRDNLHPIQLSWIVHGGAQCGFCTPGFIVSVKALLDQNPN
PTREDVREWFQTHRNACRCTGYKQLVDAVMDAAKVMRGEMKAEDLLFRIPPDGHIWGTNH
PRPSAVAKVTGTLDYGADLGLKMPADTLYLALVQAKVSHANIKGIDTSEAEKMPGVFKVV
TAKDVTGKNRITGLITFPTNKGDGWDRPILCDQKVFQYGDAIAIVCADNEYQARRAAEKV
KVDLEELPAYMSAPAAMAEDAMEIHPGTPNVYFELPVVKGGETAPLMQSAAYTAEGDYYL
QRQPHLTMETDVGCAYFDDEERLTIHSKSIAIHLHSAMIAAGVGISPNKLRLVQNPAGGT
FGYKFSPTMEALLGVACMATGRPVFLRYDYQQHITYTGKRSPFWMKVKYGADKEGKIVAM
ESDWSVDHGPYSEFGDLLTLRGAQFIGAGYGIPNIRGMGRTVCTNHAWGSAFRAYGSPQS
FLASESLIDELAEKMGIDPLELRARNVYRPGDTTPTGQVPEVFCFQEMIEKLRPIYTSAL
EKAGQNSTADVKRGVGISLGIYGCGLDGADSSEIRVALNPDNTITVFSSWEDHGQGADMG
ALGTAHKAFEPMGVQPDRIRLVMNDTAITPNSGPAGGSRSQVVTGNAIKNGCEMLMAAMR
KPDGTYRTFAEMEAENLPVSYSGQWTASMCTNCDLKTSQGEPFSVYMYGMFMAEVAVETA
TGKTTVEGFTAISDVGSINNKLVVDGQMYGGIAQGIGLALSEDFEDLSKHNNLRACGLPY
AKMIPDKMDLHYIESPRENGPFGAAGVGELPLTSSHVAVINAIHNACGVRIRHLPALPEK
VLAALKK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory