SitesBLAST
Comparing WP_054559146.1 NCBI__GCF_001306415.1:WP_054559146.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04181 Ornithine aminotransferase, mitochondrial; Ornithine delta-aminotransferase; Ornithine--oxo-acid aminotransferase; EC 2.6.1.13 from Homo sapiens (Human) (see 8 papers)
62% identity, 98% coverage: 8:423/425 of query aligns to 39:439/439 of P04181
- G51 (= G20) to D: in HOGA; loss of protein stability; loss of ornithine aminotransferase activity; dbSNP:rs11553554
- Y55 (= Y24) to H: in HOGA; decreased protein abundance; dbSNP:rs121965037
- N89 (= N58) to K: in HOGA; no effect on protein abundance; dbSNP:rs386833602
- Q90 (= Q59) to E: in HOGA; mistargeted, accumulates in cytoplasm; dbSNP:rs121965060
- C93 (= C62) to F: in HOGA; no effect on protein abundance; dbSNP:rs121965038
- Q104 (= Q73) to R: in HOGA; loss of protein stability; loss of ornithine aminotransferase activity; dbSNP:rs386833604
- R154 (= R123) to L: in HOGA; no effect on protein abundance; loss of ornithine aminotransferase activity; dbSNP:rs121965039
- R180 (= R149) to T: in HOGA; no effect on protein abundance; loss of ornithine aminotransferase activity; dbSNP:rs121965040
- A184 (≠ I153) natural variant: Missing (in HOGA; no effect on protein abundance; loss of ornithine aminotransferase activity; dbSNP:rs121965035)
- P199 (= P168) to Q: in HOGA; loss of protein stability; loss of ornithine aminotransferase activity; dbSNP:rs267606925
- A226 (= A195) to V: in HOGA; loss of protein stability; loss of ornithine aminotransferase activity; dbSNP:rs121965059
- P241 (= P210) to L: in HOGA; no effect on protein abundance; dbSNP:rs121965051
- Y245 (= Y214) to C: in HOGA; no effect on protein abundance; dbSNP:rs121965046
- R250 (≠ F219) to P: in HOGA; no effect on protein abundance; dbSNP:rs121965052
- T267 (= T236) to I: in HOGA; decreased protein abundance; dbSNP:rs386833618
- A270 (= A239) to P: decreased protein abundance; dbSNP:rs121965041
- R271 (= R240) to K: in HOGA; no effect on protein abundance; loss of ornithine aminotransferase activity; dbSNP:rs121965042
- K292 (= K273) modified: N6-(pyridoxal phosphate)lysine
- E318 (≠ N299) to K: in HOGA; loss of protein stability; loss of ornithine aminotransferase activity; dbSNP:rs386833621
- V332 (= V313) to M: in HOGA; loss of protein stability; loss of ornithine aminotransferase activity; dbSNP:rs121965047
- G353 (= G334) to D: in HOGA; decreased protein abundance; dbSNP:rs121965053
- G375 (= G358) to A: in HOGA; decreased protein abundance; dbSNP:rs121965045
- C394 (= C378) to R: in HOGA; no effect on protein abundance; dbSNP:rs121965054; to Y: in HOGA; loss of protein stability; loss of ornithine aminotransferase activity; dbSNP:rs386833597
- L402 (= L386) to P: in HOGA; may affect protein stability; loss of ornithine aminotransferase activity; dbSNP:rs121965043
- P417 (= P401) to L: in HOGA; loss of protein stability; loss of ornithine aminotransferase activity; dbSNP:rs121965044
- I436 (= I420) to N: in HOGA; loss of protein stability; loss of ornithine aminotransferase activity; dbSNP:rs386833598
- L437 (= L421) to F: in HOGA; likely benign; no effect on protein stability; no effect on ornithine aminotransferase activity; dbSNP:rs1800456
Sites not aligning to the query:
- 1:35 modified: transit peptide, Mitochondrion; in renal form
7ta0A Human ornithine aminotransferase (hoat) soaked with 5-aminovaleric acid (see paper)
62% identity, 98% coverage: 8:423/425 of query aligns to 3:403/403 of 7ta0A
- binding 5-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]pentanoic acid: Y19 (= Y24), Y49 (= Y54), G106 (= G111), V107 (≠ A112), F141 (= F146), W142 (≠ H147), D227 (= D232), I229 (≠ V234), Q230 (= Q235), K256 (= K273), S285 (= S302), T286 (= T303)
8ez1B Human ornithine aminotransferase (hoat) co-crystallized with its inactivator 3-amino-4-fluorocyclopentenecarboxylic acid (see paper)
62% identity, 98% coverage: 8:423/425 of query aligns to 2:402/402 of 8ez1B
- binding (1R,3S,4Z)-3-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-4-iminocyclopentane-1-carboxylic acid: Y48 (= Y54), T104 (= T110), G105 (= G111), V106 (≠ A112), F140 (= F146), W141 (≠ H147), E198 (= E204), D226 (= D232), I228 (≠ V234), Q229 (= Q235), K255 (= K273), R376 (= R397)
8ez1A Human ornithine aminotransferase (hoat) co-crystallized with its inactivator 3-amino-4-fluorocyclopentenecarboxylic acid (see paper)
62% identity, 98% coverage: 8:423/425 of query aligns to 2:402/402 of 8ez1A
- binding (3E,4E)-4-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)-3-iminocyclopent-1-ene-1-carboxylic acid: Y48 (= Y54), G105 (= G111), V106 (≠ A112), F140 (= F146), W141 (≠ H147), E198 (= E204), D226 (= D232), I228 (≠ V234), Q229 (= Q235), K255 (= K273), R376 (= R397)
7tfpC Human ornithine aminotransferase cocrystallized with its inhibitor, (1s,3s)-3-amino-4-(difluoromethylene)cyclopentane-1-carboxylic acid. (see paper)
62% identity, 98% coverage: 8:423/425 of query aligns to 2:402/402 of 7tfpC
- binding (1S,3S,4S)-3-amino-4-(fluoromethyl)cyclopentane-1-carboxylic acid: Y18 (= Y24), Y48 (= Y54), F140 (= F146), E198 (= E204), K255 (= K273), R376 (= R397)
- binding pyridoxal-5'-phosphate: G105 (= G111), V106 (≠ A112), F140 (= F146), W141 (≠ H147), D226 (= D232), I228 (≠ V234), Q229 (= Q235), K255 (= K273)
7lk0A Ornithine aminotransferase (oat) cocrystallized with its potent inhibitor - (s)-3-amino-4,4-difluorocyclopent-1-enecarboxylic acid (ss-1-148) (see paper)
62% identity, 98% coverage: 8:423/425 of query aligns to 2:402/402 of 7lk0A
- binding (1R,3S)-3-[(E)-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)amino]-4-oxocyclopentane-1-carboxylic acid: Y18 (= Y24), Y48 (= Y54), G105 (= G111), V106 (≠ A112), F140 (= F146), W141 (≠ H147), E198 (= E204), D226 (= D232), I228 (≠ V234), Q229 (= Q235), K255 (= K273)
7jx9A The crystal structure of human ornithine aminotransferase with an intermediate bound during inactivation by (1s,3s)-3-amino-4- (hexafluoropropan-2-ylidenyl)-cyclopentane-1-carboxylic acid. (see paper)
62% identity, 98% coverage: 8:423/425 of query aligns to 2:402/402 of 7jx9A
- active site: F140 (= F146), E193 (= E199), D226 (= D232), Q229 (= Q235), K255 (= K273), T285 (= T303), R376 (= R397)
- binding (1S,3S,4S)-3-[(E)-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)amino]-4-(1,1,3,3,3-pentafluoroprop-1-en-2-yl)cyclopentane-1-carboxylic acid: Y18 (= Y24), Y48 (= Y54), G105 (= G111), V106 (≠ A112), F140 (= F146), W141 (≠ H147), E198 (= E204), D226 (= D232), I228 (≠ V234), Q229 (= Q235), K255 (= K273), R376 (= R397)
- binding N-[1,3-dihydroxy-2-(hydroxymethyl)propan-2-yl]glycine: S149 (= S155), F163 (= F169), M164 (≠ T170), P165 (= P171), F167 (≠ M173), R180 (≠ E186), A181 (= A187)
6v8dA Design, synthesis, and mechanism of fluorine-substituted cyclohexene analogues of gama-aminobutyric acid (gaba) as selective ornithine aminotransferase inactivators
62% identity, 98% coverage: 8:423/425 of query aligns to 2:402/402 of 6v8dA
- active site: F140 (= F146), E193 (= E199), D226 (= D232), Q229 (= Q235), K255 (= K273), T285 (= T303), R376 (= R397)
- binding (3Z)-3-iminocyclohex-1-ene-1-carboxylic acid: Y48 (= Y54), K255 (= K273)
- binding pyridoxal-5'-phosphate: T104 (= T110), G105 (= G111), V106 (≠ A112), W141 (≠ H147), D226 (= D232), I228 (≠ V234), Q229 (= Q235), K255 (= K273)
2canA Human ornithine aminotransferase complexed with l-canaline (see paper)
62% identity, 98% coverage: 8:423/425 of query aligns to 2:402/402 of 2canA
- active site: F140 (= F146), E193 (= E199), D226 (= D232), Q229 (= Q235), K255 (= K273), T285 (= T303), R376 (= R397)
- binding canaline: Y18 (= Y24), F140 (= F146), R143 (= R149), G283 (= G301), S284 (= S302)
- binding pyridoxal-5'-phosphate: G105 (= G111), V106 (≠ A112), F140 (= F146), W141 (≠ H147), D226 (= D232), I228 (≠ V234), Q229 (= Q235), K255 (= K273)
1gbnB Human ornithine aminotransferase complexed with the neurotoxin gabaculine (see paper)
62% identity, 98% coverage: 8:423/425 of query aligns to 2:402/402 of 1gbnB
- active site: F140 (= F146), E193 (= E199), D226 (= D232), Q229 (= Q235), K255 (= K273), T285 (= T303), R376 (= R397)
- binding gabaculine: Y18 (= Y24), Y48 (= Y54), F140 (= F146), E198 (= E204), K255 (= K273)
- binding pyridoxal-5'-phosphate: G105 (= G111), V106 (≠ A112), F140 (= F146), W141 (≠ H147), D226 (= D232), I228 (≠ V234), K255 (= K273)
1gbnA Human ornithine aminotransferase complexed with the neurotoxin gabaculine (see paper)
62% identity, 98% coverage: 8:423/425 of query aligns to 2:402/402 of 1gbnA
- active site: F140 (= F146), E193 (= E199), D226 (= D232), Q229 (= Q235), K255 (= K273), T285 (= T303), R376 (= R397)
- binding 3-aminobenzoic acid: Y18 (= Y24), Y48 (= Y54), E198 (= E204), K255 (= K273)
- binding pyridoxal-5'-phosphate: G105 (= G111), V106 (≠ A112), F140 (= F146), W141 (≠ H147), D226 (= D232), I228 (≠ V234), K255 (= K273)
8v9mA Human ornithine aminotransferase cocrystallized with its inhibitor, (r)-3-amino-5,5-difluorocyclohex-1-ene-1-carboxylic acid. (see paper)
62% identity, 98% coverage: 8:423/425 of query aligns to 4:404/404 of 8v9mA
- binding 3-fluoro-5-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]benzoic acid: Y20 (= Y24), Y50 (= Y54), G107 (= G111), V108 (≠ A112), F142 (= F146), W143 (≠ H147), E200 (= E204), D228 (= D232), I230 (≠ V234), Q231 (= Q235), K257 (= K273), K370 (= K389)
7tedA Human ornithine aminotransferase cocrystallized with its inhibitor, (s,e)-3-amino-4-(fluoromethylene)cyclopent-1-ene-1-carboxylate (see paper)
62% identity, 98% coverage: 8:423/425 of query aligns to 4:404/404 of 7tedA
- binding (1S,3R,4S)-3-formyl-4-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]cyclopentane-1-carboxylic acid: Y20 (= Y24), Y50 (= Y54), G107 (= G111), V108 (≠ A112), F142 (= F146), W143 (≠ H147), G144 (= G148), E200 (= E204), D228 (= D232), I230 (≠ V234), Q231 (= Q235), K257 (= K273), S286 (= S302), T287 (= T303)
7ta1A Human ornithine aminotransferase (hoat) soaked with gamma-aminobutyric acid (see paper)
62% identity, 98% coverage: 8:423/425 of query aligns to 4:404/404 of 7ta1A
7lnmB Ornithine aminotransferase (oat) cocrystallized with its inactivator - (1s,3s)-3-amino-4-(difluoromethylene)cyclopentene-1-carboxylic acid (see paper)
62% identity, 98% coverage: 8:423/425 of query aligns to 4:404/404 of 7lnmB
- binding (1~{R},3~{S},4~{R})-3-methyl-4-[[2-methyl-3-oxidanyl-5-(phosphonooxymethyl)pyridin-4-yl]methylamino]cyclopentane-1-carboxylic acid: Y50 (= Y54), G107 (= G111), V108 (≠ A112), F142 (= F146), W143 (≠ H147), D228 (= D232), I230 (≠ V234), Q231 (= Q235), K257 (= K273)
7lk1A Ornithine aminotransferase (oat) with its potent inhibitor - (s)-3- amino-4,4-difluorocyclopent-1-enecarboxylic acid (ss-1-148) - 1 hour soaking (see paper)
62% identity, 98% coverage: 8:423/425 of query aligns to 4:404/404 of 7lk1A
- binding (1R,4R)-4-fluoro-3-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]cyclopent-2-ene-1-carboxylic acid: Y50 (= Y54), G107 (= G111), V108 (≠ A112), F142 (= F146), W143 (≠ H147), E200 (= E204), D228 (= D232), I230 (≠ V234), Q231 (= Q235), K257 (= K273), R378 (= R397)
6v8cA Design, synthesis, and mechanism of fluorine-substituted cyclohexene analogues of gama-aminobutyric acid (gaba) as selective ornithine aminotransferase inactivators
62% identity, 98% coverage: 8:423/425 of query aligns to 4:404/404 of 6v8cA
- active site: F142 (= F146), E195 (= E199), D228 (= D232), Q231 (= Q235), K257 (= K273), T287 (= T303), R378 (= R397)
- binding pyridoxal-5'-phosphate: G107 (= G111), V108 (≠ A112), F142 (= F146), W143 (≠ H147), D228 (= D232), I230 (≠ V234), K257 (= K273)
- binding 3-aminocyclohexa-1,3-diene-1-carboxylic acid: Y20 (= Y24), Y50 (= Y54), F142 (= F146), K257 (= K273)
6oiaA (1s,3s)-3-amino-4-(perfluoropropan-2-ylidene)cyclopentane-1-carboxylic acid hydrochloride, a potent inhibitor of ornithine aminotransferase (see paper)
62% identity, 98% coverage: 8:423/425 of query aligns to 4:404/404 of 6oiaA
- active site: F142 (= F146), E195 (= E199), D228 (= D232), Q231 (= Q235), K257 (= K273), T287 (= T303), R378 (= R397)
- binding (1S)-3-amino-4-[(2S)-1,1,1-trifluoro-3-oxopropan-2-yl]cyclopent-3-ene-1-carboxylic acid: S286 (= S302), T287 (= T303)
- binding pyridoxal-5'-phosphate: G107 (= G111), V108 (≠ A112), F142 (= F146), W143 (≠ H147), D228 (= D232), I230 (≠ V234), K257 (= K273)
5vwoA Ornithine aminotransferase inactivated by (1r,3s,4s)-3-amino-4- fluorocyclopentane-1-carboxylic acid (fcp) (see paper)
62% identity, 98% coverage: 8:423/425 of query aligns to 4:404/404 of 5vwoA
- active site: F142 (= F146), E195 (= E199), D228 (= D232), Q231 (= Q235), K257 (= K273), T287 (= T303), R378 (= R397)
- binding (1S,3S,4E)-3-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-4-iminocyclopentane-1-carboxylic acid: Y50 (= Y54), G107 (= G111), V108 (≠ A112), F142 (= F146), W143 (≠ H147), G144 (= G148), R145 (= R149), E200 (= E204), D228 (= D232), I230 (≠ V234), Q231 (= Q235), K257 (= K273)
2oatA Ornithine aminotransferase complexed with 5-fluoromethylornithine (see paper)
62% identity, 98% coverage: 8:423/425 of query aligns to 4:404/404 of 2oatA
- active site: F142 (= F146), E195 (= E199), D228 (= D232), Q231 (= Q235), K257 (= K273), T287 (= T303), R378 (= R397)
- binding 1-amino-7-(2-methyl-3-oxido-5-((phosphonoxy)methyl)-4-pyridoxal-5-oxo-6-heptenate: Y20 (= Y24), G107 (= G111), V108 (≠ A112), F142 (= F146), W143 (≠ H147), R145 (= R149), E195 (= E199), E200 (= E204), D228 (= D232), Q231 (= Q235), K257 (= K273), G285 (= G301), T287 (= T303)
Query Sequence
>WP_054559146.1 NCBI__GCF_001306415.1:WP_054559146.1
MAVLQHITSQEAIDLENKYGAQNYHPLPVVLSRGEGVFVWDVEGKKYYDFLSAYSAVNQG
HCHPKIINALKNQAENLTLTSRAFYNDMLGKYEKFATEFFGFDKLLPMNTGAEAVETALK
LARKWGYEKKGIPANKAKIIVCQNNFHGRTISIISASNDPVATENFGPFTPGMLSIRYND
IAALAEALKDEHVAAFMVEPIQGEAGVYVPDENYIKEAFELCKSKNVLFIADEVQTGIAR
TGRLLASCGNCSCSDKNCSGVPDVKPDVLILGKAISGGVFPVSAVLANNDIMEVIRPGNH
GSTFGGNPLACAVAIAALEVVKEENLAENAFQLGELFRSEMQKLVAETDLVRLVRGKGLL
NAIVINDTEDSSTAWNICVALKDNGLLAKPTHGNIIRFAPPLVMTKEELLDCISIIRKTI
LQFKA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory