Comparing WP_055093224.1 NCBI__GCF_900100165.1:WP_055093224.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
P9WKJ3 Putative acetolactate synthase small subunit; Acetohydroxy-acid synthase small subunit; AHAS; ALS; EC 2.2.1.6 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
32% identity, 89% coverage: 5:161/176 of query aligns to 4:159/168 of P9WKJ3
A0QUX7 Acetolactate synthase small subunit; Acetohydroxy-acid synthase small subunit; AHAS; ALS; EC 2.2.1.6 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
32% identity, 89% coverage: 5:161/176 of query aligns to 6:161/170 of A0QUX7
Q9FFF4 Acetolactate synthase small subunit 2, chloroplastic; ALS-interacting protein 3; Acetohydroxy-acid synthase small subunit 2; Protein valine-tolerant 1 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
32% identity, 91% coverage: 8:168/176 of query aligns to 78:235/477 of Q9FFF4
Sites not aligning to the query:
6vz8G Arabidopsis thaliana acetohydroxyacid synthase complex with valine bound (see paper)
28% identity, 90% coverage: 5:162/176 of query aligns to 2:158/159 of 6vz8G
Q93YZ7 Acetolactate synthase small subunit 1, chloroplastic; ALS-interacting protein 1; Acetohydroxyacid synthase small subunit 1 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
28% identity, 90% coverage: 5:162/176 of query aligns to 318:474/491 of Q93YZ7
Sites not aligning to the query:
6vz8F Arabidopsis thaliana acetohydroxyacid synthase complex with valine bound (see paper)
29% identity, 91% coverage: 5:164/176 of query aligns to 3:159/159 of 6vz8F
6wo1B Hybrid acetohydroxyacid synthase complex structure with cryptococcus neoformans ahas catalytic subunit and saccharomyces cerevisiae ahas regulatory subunit (see paper)
23% identity, 89% coverage: 5:161/176 of query aligns to 3:195/197 of 6wo1B
O60086 Probable acetolactate synthase small subunit; Acetohydroxy-acid synthase small subunit; AHAS; ALS from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
19% identity, 93% coverage: 1:163/176 of query aligns to 65:266/289 of O60086
Sites not aligning to the query:
6u9dL Saccharomyces cerevisiae acetohydroxyacid synthase (see paper)
19% identity, 95% coverage: 2:168/176 of query aligns to 33:247/255 of 6u9dL
>WP_055093224.1 NCBI__GCF_900100165.1:WP_055093224.1
MEENKTFTISVYTENNVGLLNRISVIFLKRHINILSLNVSESEIENVSRFVIVVDTTEKW
VRNIVGQIEKQVEVIKAFYHVDEETIFLESALFKIASNLLFDERQIQNIIKESHSEIVTV
SRDFFVISKVGRRSEIEELYAKLKPFGIMQFVRSGRISVSKEKMEVTSLLLEELKS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory